SimulationCraft 902-01

for World of Warcraft 9.0.2.36639 Live (wow build level 36639)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

dark_iron_dwarf : 5119 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5118.8 5118.8 9.9 / 0.194% 838.2 / 16.4% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
798.1 793.4 Mana 0.00% 57.7 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
dark_iron_dwarf 5119
Conflagration Flare Up 24 0.5% 30.1 9.56sec 241 0 Direct 30.1 150 383 241 38.9%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.08 30.08 0.00 0.00 0.0000 0.0000 7241.64 7241.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.07% 18.37 5 35 150.01 130 255 150.12 131 177 2756 2756 0.00%
crit 38.93% 11.71 3 25 383.13 259 552 383.02 262 482 4485 4485 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.8 90.17sec 3901 3356 Direct 0.8 0 3900 3900 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.84 0.84 0.00 0.00 1.1625 0.0000 3262.42 3262.42 0.00% 3356.40 3356.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.84 0 4 3900.49 3785 4396 2414.71 0 4396 3262 3262 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [f]:0.83
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 159 3.1% 3.3 103.76sec 14449 0 Direct 3.3 11655 23301 14486 24.4%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.31 3.30 0.00 0.00 0.0000 0.0000 47806.64 47806.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.61% 2.49 0 4 11655.13 11342 12023 11478.18 0 12023 29066 29066 0.00%
crit 24.39% 0.80 0 4 23301.46 22685 24046 13999.29 0 24046 18741 18741 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 609 11.9% 42.3 7.14sec 4322 0 Direct 42.3 0 4322 4322 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.31 42.31 0.00 0.00 0.0000 0.0000 182845.40 182845.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.31 33 50 4322.04 3043 6480 4323.72 4086 4578 182845 182845 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [V]:16.71
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [i]:3.01
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [j]:5.31
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [s]:17.27
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 613 (642) 12.0% (12.5%) 77.5 3.41sec 2484 1494 Direct 77.5 (221.0) 1654 3459 2374 39.9% (39.9%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.54 77.53 0.00 0.00 1.6622 0.0000 184051.63 184051.63 0.00% 1494.37 1494.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.10% 46.59 28 67 1653.58 1436 2574 1654.01 1539 1810 77044 77044 0.00%
crit 39.90% 30.94 19 45 3458.85 2872 6115 3462.72 3232 3743 107007 107007 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [d]:4.69
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [o]:20.83
    standard_rotation
    [x]:52.07
    Conflagration 29 0.6% 77.5 3.40sec 110 0 Periodic 143.5 35 92 60 42.7% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.53 0.00 143.46 143.46 0.0000 1.4473 8551.87 8551.87 0.00% 41.19 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.25% 82.13 59 110 35.49 0 57 35.49 33 38 2915 2915 0.00%
crit 42.75% 61.32 41 84 91.92 0 135 91.99 84 100 5637 5637 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 970 18.9% 264.6 1.13sec 1100 0 Periodic 299.2 973 0 973 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.58 0.00 299.20 299.20 0.0000 1.0000 291124.42 291124.42 0.00% 973.01 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 972.92 161 2995 973.99 838 1141 291124 291124 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.43sec 3711 4796

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7740 0.0000 0.00 0.00 0.00% 4796.42 4796.42

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 34 Direct 235.3 38 76 47 24.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.00 235.25 0.00 0.00 1.3988 0.0000 11103.72 11103.72 0.00% 33.64 33.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.58% 177.79 114 207 37.92 29 57 38.01 35 42 6743 6743 0.00%
crit 24.42% 57.46 28 83 75.89 57 115 76.05 65 89 4361 4361 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.70
Phoenix Flames 0 (251) 0.0% (4.9%) 14.1 21.64sec 5331 4842

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.13 0.00 0.00 0.00 1.1011 0.0000 0.00 0.00 0.00% 4841.74 4841.74

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [c]:10.12
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [m]:1.32
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [u]:2.69
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 251 4.9% 14.1 21.65sec 5343 0 Direct 14.1 2095 6238 5345 78.4%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 0.00 0.00 0.0000 0.0000 75327.83 75327.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.60% 3.04 0 10 2095.47 1729 3396 2068.56 0 3396 6378 6378 0.00%
crit 78.40% 11.05 6 16 6237.51 3458 7363 6243.22 5336 6757 68950 68950 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2072 (2204) 40.5% (43.1%) 96.3 3.10sec 6870 6145 Direct 97.0 (274.7) 3082 7916 6412 68.9% (68.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.28 96.98 0.00 0.00 1.1179 0.0000 621843.88 621843.88 0.00% 6145.37 6145.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.11% 30.18 18 47 3081.93 2619 5143 3082.20 2760 3394 93006 93006 0.00%
crit 68.89% 66.81 37 108 7916.00 5237 11151 7941.65 7114 8931 528837 528837 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Z]:7.08
  • if_expr:buff.firestorm.react
    combustion_phase
    [a]:25.40
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [b]:3.21
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [g]:4.94
  • if_expr:buff.firestorm.react
    rop_phase
    [h]:9.43
  • if_expr:buff.hot_streak.react
    rop_phase
    [l]:3.37
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [p]:12.36
  • if_expr:buff.firestorm.react
    standard_rotation
    [q]:15.41
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [r]:4.22
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [t]:10.86
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.6% 97.0 3.10sec 408 0 Periodic 177.7 136 355 223 39.5% 86.5%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.98 0.00 177.74 177.74 0.0000 1.4624 39563.79 39563.79 0.00% 152.20 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.51% 107.55 70 146 136.10 5 234 136.12 128 145 14639 14639 0.00%
crit 39.49% 70.19 47 102 355.09 10 507 355.54 328 390 24925 24925 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 211 4.1% 33.7 7.77sec 1887 1636 Direct 33.7 0 1887 1887 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.70 33.69 0.00 0.00 1.1531 0.0000 63577.28 63577.28 0.00% 1636.27 1636.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.69 17 51 1887.18 1009 3620 1887.97 1698 2152 63577 63577 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [e]:3.68
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [n]:8.01
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [w]:22.39
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
dark_iron_dwarf
Combustion 4.7 70.81sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [X]:4.67
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Fireblood 2.6 146.58sec

Stats Details: Fireblood

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.63 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Fireblood

  • id:265221
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:265221
  • name:Fireblood
  • school:physical
  • tooltip:
  • description:Removes all poison, disease, curse, magic, and bleed effects and increases your $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] by ${{$265226s1=61}*3} and an additional {$265226s1=61} for each effect removed. Lasts {$265226d=8 seconds}. {$?s195710=false}[This effect shares a 30 sec cooldown with other similar effects.][]

Action Priority List

    combustion_cooldowns
    [T]:2.63
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dark_iron_dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dark_iron_dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.19
Rune of Power 5.3 60.49sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 0.00 0.00 0.00 1.1120 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.34
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.8sec 70.8sec 11.8sec 18.41% 0.00% 105.8 (105.8) 4.5

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:51.6s / 89.0s
  • trigger_min/max:51.6s / 89.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.41%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.6 25.0 9.1sec 4.2sec 5.1sec 36.91% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 46.5s
  • trigger_min/max:1.3s / 41.3s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 33.6s

Stack Uptimes

  • fireball_1:20.53%
  • fireball_2:9.09%
  • fireball_3:4.46%
  • fireball_4:1.94%
  • fireball_5:0.68%
  • fireball_6:0.18%
  • fireball_7:0.03%
  • fireball_8:0.02%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Fireblood 2.6 0.0 141.8sec 146.5sec 7.9sec 6.87% 0.00% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_fireblood
  • max_stacks:6
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:183.00

Trigger Details

  • interval_min/max:120.4s / 163.6s
  • trigger_min/max:128.8s / 163.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • fireblood_1:6.87%

Spelldata

  • id:265226
  • name:Fireblood
  • tooltip:Increases $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] by $w1.
  • description:Increases $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] by {$s1=61}.
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.7 0.8 36.7sec 32.9sec 4.2sec 10.87% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 161.0s
  • trigger_min/max:0.8s / 161.0s
  • trigger_pct:10.06%
  • duration_min/max:0.0s / 15.2s

Stack Uptimes

  • firestorm_1:10.87%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.3sec 72.8sec 14.7sec 22.91% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 89.0s
  • trigger_min/max:60.0s / 89.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.91%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.1 0.0 3.1sec 3.1sec 1.1sec 35.12% 46.70% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 18.5s
  • trigger_min/max:0.2s / 18.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.6s

Stack Uptimes

  • heating_up_1:35.12%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.2 0.0 3.6sec 3.6sec 0.6sec 13.00% 86.57% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 30.4s
  • trigger_min/max:0.6s / 30.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s

Stack Uptimes

  • hot_streak_1:13.00%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 308.8sec 0.0sec 23.7sec 9.42% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.42%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.1sec 12.0sec 38.97% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 71.0s
  • trigger_min/max:2.5s / 71.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • rune_of_power_1:38.97%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.1 72.0 123.0 3.1s 0.2s 18.5s
Heating Up removed 11.5 3.0 23.0 23.6s 0.9s 208.6s
Heating Up converted with Fire Blast 23.4 13.0 34.0 12.1s 0.6s 99.6s
Hot Streak procs 84.2 63.0 109.0 3.6s 0.6s 30.4s
Hot Streak spells used 264.6 212.0 320.0 1.1s 0.0s 5.6s
Hot Streak spell crits 184.8 139.0 237.0 1.6s 0.0s 16.8s
Hot Streak spell crits wasted 4.6 0.0 12.0 65.5s 0.1s 320.2s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.05% 7.96% 18.82% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3240.00012.7260.9690.00013.544
Rune of Power13.8810.00038.11475.77021.961129.328
Fire Blast0.0950.00024.2524.0281.30033.144
Dragon's Breath138.14342.417345.918285.719187.132359.846
Combustion2.1961.30010.75910.3115.49920.146
Phoenix Flames0.2110.00032.9403.0041.73934.681

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
dark_iron_dwarf
mana_regen Mana 2172.92 238414.92 100.00% 109.72 61734.26 20.57%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.44 798.10 61740.7 48601.7 42426.0 50000.0
Usage Type Count Total Avg RPE APR
dark_iron_dwarf
combustion Mana 4.7 23341.0 5000.0 5003.3 0.0
dragons_breath Mana 0.8 1666.5 2000.0 1992.6 2.0
fire_blast Mana 42.3 21153.5 500.0 500.0 8.6
fireball Mana 77.6 77556.8 1000.0 1000.2 2.5
mirror_image Mana 3.0 1991.9 665.8 665.8 5.6
pyroblast Mana 97.3 97279.9 1000.0 1010.4 6.8
scorch Mana 33.7 16836.7 500.0 499.6 3.8

Statistics & Data Analysis

Fight Length
dark_iron_dwarf Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
dark_iron_dwarf Damage Per Second
Count 1717
Mean 5118.75
Minimum 4539.71
Maximum 5858.35
Spread ( max - min ) 1318.64
Range [ ( max - min ) / 2 * 100% ] 12.88%
Standard Deviation 209.4978
5th Percentile 4796.54
95th Percentile 5491.64
( 95th Percentile - 5th Percentile ) 695.10
Mean Distribution
Standard Deviation 5.0559
95.00% Confidence Interval ( 5108.84 - 5128.66 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6435
0.1 Scale Factor Error with Delta=300 375
0.05 Scale Factor Error with Delta=300 1499
0.01 Scale Factor Error with Delta=300 37467
Priority Target DPS
dark_iron_dwarf Priority Target Damage Per Second
Count 1717
Mean 5118.75
Minimum 4539.71
Maximum 5858.35
Spread ( max - min ) 1318.64
Range [ ( max - min ) / 2 * 100% ] 12.88%
Standard Deviation 209.4978
5th Percentile 4796.54
95th Percentile 5491.64
( 95th Percentile - 5th Percentile ) 695.10
Mean Distribution
Standard Deviation 5.0559
95.00% Confidence Interval ( 5108.84 - 5128.66 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6435
0.1 Scale Factor Error with Delta=300 375
0.05 Scale Factor Error with Delta=300 1499
0.01 Scale Factor Error with Delta=300 37467
DPS(e)
dark_iron_dwarf Damage Per Second (Effective)
Count 1717
Mean 5118.75
Minimum 4539.71
Maximum 5858.35
Spread ( max - min ) 1318.64
Range [ ( max - min ) / 2 * 100% ] 12.88%
Damage
dark_iron_dwarf Damage
Count 1717
Mean 1525196.80
Minimum 1167193.12
Maximum 1954169.43
Spread ( max - min ) 786976.31
Range [ ( max - min ) / 2 * 100% ] 25.80%
DTPS
dark_iron_dwarf Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
dark_iron_dwarf Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
dark_iron_dwarf Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
dark_iron_dwarf Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
dark_iron_dwarf Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
dark_iron_dwarf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
dark_iron_dwarfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
dark_iron_dwarf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.31 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.34 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.19 potion
0.00 blood_fury
0.00 berserking
T 2.63 fireblood
0.00 ancestral_call
0.00 use_items
U 4.66 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
V 16.71 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
W 0.00 call_action_list,name=active_talents
X 4.67 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Y 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Z 7.08 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
a 25.40 pyroblast,if=buff.hot_streak.react&buff.combustion.up
b 3.21 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
c 10.12 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
d 4.69 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
e 3.68 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
f 0.83 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
g 4.94 pyroblast,if=buff.firestorm.react
h 9.43 pyroblast,if=buff.hot_streak.react
i 3.01 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
j 5.31 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
k 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
l 3.37 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
m 1.32 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
n 8.01 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
o 20.83 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
p 12.36 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
q 15.41 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
r 4.22 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
s 17.27 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
t 10.86 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
u 2.69 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
v 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
w 22.39 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
x 52.07 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTUdXVcaVaVacaZZZZVacaVOhoooojNhooooxsqxxxqxqxqxxxxxxsqxsqxxxxxxxsqxdXVUcaVaVacaebcaVOhoogggojhoxxsqxxqxxsqxxNxxxxsqMxxxsqxxxxxxxdXVTUcaVaVacaeVaaZOgmoooooigpppppxqxxsqxsqxsqxxsqpppxxxxxxdXVUcaVacaVaebebOojhooniNlgggruwstwtwwMrwstwwtwstwwtwwsrwwtwwOhinhnhnhjhnnlwtZZZdXTUaaVaVacacaeVapppwtuwstwwtOsgghnnNlnjh

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask dark_iron_dwarf 50000.0/50000: 100% mana
Pre precombat 1 food dark_iron_dwarf 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T fireblood Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana fireblood, potion_of_spectral_intellect
0:00.000 combustion_phase d fireball Fluffy_Pillow 49000.0/50000: 98% mana fireblood, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, fireblood, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, fireblood, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.742 combustion_phase c phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana bloodlust, fireblood, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.636 combustion_phase a pyroblast Fluffy_Pillow 44836.0/50000: 90% mana bloodlust, fireblood, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.636 combustion_phase V fire_blast Fluffy_Pillow 43836.0/50000: 88% mana bloodlust, fireblood, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase a pyroblast Fluffy_Pillow 44231.0/50000: 88% mana bloodlust, fireblood, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase V fire_blast Fluffy_Pillow 43231.0/50000: 86% mana bloodlust, fireblood, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.427 combustion_phase a pyroblast Fluffy_Pillow 43627.0/50000: 87% mana bloodlust, fireblood, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.320 combustion_phase c phoenix_flames Fluffy_Pillow 43520.0/50000: 87% mana bloodlust, fireblood, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.215 combustion_phase a pyroblast Fluffy_Pillow 44415.0/50000: 89% mana bloodlust, fireblood, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:07.108 combustion_phase Z pyroblast Fluffy_Pillow 44308.0/50000: 89% mana bloodlust, fireblood, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:08.002 combustion_phase Z pyroblast Fluffy_Pillow 44202.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:08.897 combustion_phase Z pyroblast Fluffy_Pillow 44097.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:09.792 combustion_phase Z pyroblast Fluffy_Pillow 43992.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:09.992 combustion_phase V fire_blast Fluffy_Pillow 43192.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.688 combustion_phase a pyroblast Fluffy_Pillow 43388.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.581 combustion_phase c phoenix_flames Fluffy_Pillow 43281.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.474 combustion_phase a pyroblast Fluffy_Pillow 44174.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.274 combustion_phase V fire_blast Fluffy_Pillow 43974.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.369 default O rune_of_power Fluffy_Pillow 43569.0/50000: 87% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:14.264 rop_phase h pyroblast Fluffy_Pillow 44464.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.160 rop_phase o fireball Fluffy_Pillow 44360.0/50000: 89% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:16.501 rop_phase o fireball Fluffy_Pillow 44701.0/50000: 89% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.841 rop_phase o fireball Fluffy_Pillow 45041.0/50000: 90% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:19.181 rop_phase o fireball Fluffy_Pillow 45381.0/50000: 91% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:20.481 rop_phase j fire_blast Fluffy_Pillow 46681.0/50000: 93% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:20.523 default N use_item_dreadfire_vessel Fluffy_Pillow 45223.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:20.523 rop_phase h pyroblast Fluffy_Pillow 45223.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:21.419 rop_phase o fireball Fluffy_Pillow 45119.0/50000: 90% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:22.760 rop_phase o fireball Fluffy_Pillow 45460.0/50000: 91% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:24.101 rop_phase o fireball Fluffy_Pillow 45801.0/50000: 92% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:25.440 rop_phase o fireball Fluffy_Pillow 46140.0/50000: 92% mana bloodlust, heating_up, rune_of_power
0:26.781 standard_rotation x fireball Fluffy_Pillow 46481.0/50000: 93% mana bloodlust, fireball
0:28.081 standard_rotation s fire_blast Fluffy_Pillow 47781.0/50000: 96% mana bloodlust, heating_up
0:28.122 standard_rotation q pyroblast Fluffy_Pillow 46322.0/50000: 93% mana bloodlust, hot_streak
0:29.015 standard_rotation x fireball Fluffy_Pillow 46215.0/50000: 92% mana bloodlust, heating_up
0:30.356 standard_rotation x fireball Fluffy_Pillow 46556.0/50000: 93% mana bloodlust, heating_up
0:31.697 standard_rotation x fireball Fluffy_Pillow 46897.0/50000: 94% mana bloodlust, hot_streak
0:33.036 standard_rotation q pyroblast Fluffy_Pillow 47236.0/50000: 94% mana bloodlust, fireball, hot_streak
0:33.931 standard_rotation x fireball Fluffy_Pillow 47131.0/50000: 94% mana bloodlust, hot_streak
0:35.272 standard_rotation q pyroblast Fluffy_Pillow 47472.0/50000: 95% mana bloodlust, hot_streak
0:36.167 standard_rotation x fireball Fluffy_Pillow 47367.0/50000: 95% mana bloodlust, hot_streak
0:37.507 standard_rotation q pyroblast Fluffy_Pillow 47707.0/50000: 95% mana bloodlust, hot_streak
0:38.403 standard_rotation x fireball Fluffy_Pillow 47603.0/50000: 95% mana bloodlust, fireball
0:39.743 standard_rotation x fireball Fluffy_Pillow 47943.0/50000: 96% mana bloodlust, fireball
0:41.083 standard_rotation x fireball Fluffy_Pillow 48283.0/50000: 97% mana fireball(2)
0:42.822 standard_rotation x fireball Fluffy_Pillow 49002.0/50000: 98% mana fireball(3)
0:44.565 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(4)
0:46.307 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(5)
0:47.607 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:48.049 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
0:49.210 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana heating_up
0:50.510 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:50.950 standard_rotation q pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak
0:52.110 standard_rotation x fireball Fluffy_Pillow 49100.0/50000: 98% mana fireball
0:53.850 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
0:55.590 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
0:57.331 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
0:59.072 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
1:00.812 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana heating_up
1:02.553 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:03.853 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:04.296 standard_rotation q pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak
1:05.458 standard_rotation x fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
1:07.198 combustion_phase d fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
1:08.498 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
1:08.498 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power
1:08.938 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power
1:08.938 combustion_phase c phoenix_flames Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, gladiators_badge
1:10.101 combustion_phase a pyroblast Fluffy_Pillow 45103.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:10.101 combustion_phase V fire_blast Fluffy_Pillow 44103.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
1:11.263 combustion_phase a pyroblast Fluffy_Pillow 44765.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:11.663 combustion_phase V fire_blast Fluffy_Pillow 44165.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
1:12.427 combustion_phase a pyroblast Fluffy_Pillow 44429.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:13.588 combustion_phase c phoenix_flames Fluffy_Pillow 44590.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.749 combustion_phase a pyroblast Fluffy_Pillow 45751.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:15.912 combustion_phase e scorch Fluffy_Pillow 45914.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
1:17.073 combustion_phase b pyroblast Fluffy_Pillow 46575.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:18.247 combustion_phase c phoenix_flames Fluffy_Pillow 46749.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:19.408 combustion_phase a pyroblast Fluffy_Pillow 47910.0/50000: 96% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:19.408 combustion_phase V fire_blast Fluffy_Pillow 46910.0/50000: 94% mana combustion, rune_of_power, gladiators_badge
1:20.570 default O rune_of_power Fluffy_Pillow 47572.0/50000: 95% mana hot_streak, gladiators_badge
1:21.732 rop_phase h pyroblast Fluffy_Pillow 48734.0/50000: 97% mana hot_streak, rune_of_power, gladiators_badge
1:22.893 rop_phase o fireball Fluffy_Pillow 48895.0/50000: 98% mana heating_up, rune_of_power, gladiators_badge
1:24.635 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up, rune_of_power
1:26.377 rop_phase g pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak, rune_of_power, firestorm
1:27.539 rop_phase g pyroblast Fluffy_Pillow 49167.0/50000: 98% mana fireball, heating_up, rune_of_power, firestorm
1:28.702 rop_phase g pyroblast Fluffy_Pillow 49330.0/50000: 99% mana fireball, hot_streak, rune_of_power, firestorm
1:29.864 rop_phase o fireball Fluffy_Pillow 49492.0/50000: 99% mana fireball, heating_up, rune_of_power
1:31.164 rop_phase j fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up, rune_of_power
1:31.606 rop_phase h pyroblast Fluffy_Pillow 48942.0/50000: 98% mana fireball, hot_streak, rune_of_power
1:32.768 rop_phase o fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball(2), heating_up, rune_of_power
1:34.509 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), heating_up
1:36.251 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
1:37.551 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:37.993 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
1:39.154 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana heating_up
1:40.897 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up
1:42.640 standard_rotation q pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
1:43.803 standard_rotation x fireball Fluffy_Pillow 49169.0/50000: 98% mana fireball
1:45.544 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:46.844 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:47.286 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
1:48.447 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
1:50.189 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:51.931 default N use_item_dreadfire_vessel Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:51.931 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:53.672 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
1:55.413 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
1:57.156 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(5)
1:58.456 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:58.897 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
2:00.061 default M mirror_image Fluffy_Pillow 49105.0/50000: 98% mana fireball
2:01.224 standard_rotation x fireball Fluffy_Pillow 49268.0/50000: 99% mana fireball
2:02.967 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
2:04.707 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
2:06.007 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:06.448 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
2:07.612 standard_rotation x fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball, heating_up
2:09.353 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, heating_up
2:11.095 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:12.836 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
2:14.576 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(4)
2:16.317 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(5)
2:18.058 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:19.800 combustion_phase d fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:21.100 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:21.100 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power
2:21.542 combustion_cooldowns T fireblood Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power
2:21.542 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana fireblood, combustion, hot_streak, rune_of_power
2:21.542 combustion_phase c phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
2:22.704 combustion_phase a pyroblast Fluffy_Pillow 45104.0/50000: 90% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
2:22.704 combustion_phase V fire_blast Fluffy_Pillow 44104.0/50000: 88% mana fireblood, combustion, rune_of_power, gladiators_badge
2:23.865 combustion_phase a pyroblast Fluffy_Pillow 44765.0/50000: 90% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
2:23.865 combustion_phase V fire_blast Fluffy_Pillow 43765.0/50000: 88% mana fireblood, combustion, rune_of_power, gladiators_badge
2:25.028 combustion_phase a pyroblast Fluffy_Pillow 44428.0/50000: 89% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
2:26.191 combustion_phase c phoenix_flames Fluffy_Pillow 44591.0/50000: 89% mana fireblood, combustion, heating_up, rune_of_power, gladiators_badge
2:27.354 combustion_phase a pyroblast Fluffy_Pillow 45754.0/50000: 92% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
2:28.516 combustion_phase e scorch Fluffy_Pillow 45916.0/50000: 92% mana fireblood, combustion, heating_up, rune_of_power, gladiators_badge
2:28.916 combustion_phase V fire_blast Fluffy_Pillow 46316.0/50000: 93% mana fireblood, combustion, heating_up, rune_of_power, gladiators_badge
2:29.679 combustion_phase a pyroblast Fluffy_Pillow 46079.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:30.843 combustion_phase a pyroblast Fluffy_Pillow 46243.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:32.007 combustion_phase Z pyroblast Fluffy_Pillow 46407.0/50000: 93% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
2:33.169 default O rune_of_power Fluffy_Pillow 46569.0/50000: 93% mana hot_streak, firestorm, gladiators_badge
2:34.331 rop_phase g pyroblast Fluffy_Pillow 47731.0/50000: 95% mana hot_streak, rune_of_power, firestorm, gladiators_badge
2:35.492 rop_phase m phoenix_flames Fluffy_Pillow 47892.0/50000: 96% mana heating_up, rune_of_power, gladiators_badge
2:36.654 rop_phase o fireball Fluffy_Pillow 49054.0/50000: 98% mana rune_of_power
2:38.395 rop_phase o fireball Fluffy_Pillow 49004.0/50000: 98% mana rune_of_power
2:40.137 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
2:41.878 rop_phase o fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power
2:43.620 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), rune_of_power
2:44.320 rop_phase i fire_blast Fluffy_Pillow 49705.0/50000: 99% mana heating_up, rune_of_power
2:45.361 rop_phase g pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, rune_of_power, firestorm
2:46.522 standard_rotation p pyroblast Fluffy_Pillow 49165.0/50000: 98% mana fireball, heating_up, firestorm
2:47.685 standard_rotation p pyroblast Fluffy_Pillow 49328.0/50000: 99% mana fireball, hot_streak, firestorm
2:48.848 standard_rotation p pyroblast Fluffy_Pillow 49491.0/50000: 99% mana fireball, heating_up, firestorm
2:50.011 standard_rotation p pyroblast Fluffy_Pillow 49654.0/50000: 99% mana fireball, hot_streak, firestorm
2:51.173 standard_rotation p pyroblast Fluffy_Pillow 49816.0/50000: 100% mana fireball, heating_up, firestorm
2:52.336 standard_rotation x fireball Fluffy_Pillow 49979.0/50000: 100% mana fireball, hot_streak
2:54.079 standard_rotation q pyroblast Fluffy_Pillow 49006.0/50000: 98% mana fireball, hot_streak
2:55.242 standard_rotation x fireball Fluffy_Pillow 49169.0/50000: 98% mana fireball(2)
2:56.983 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:58.283 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:58.723 standard_rotation q pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak
2:59.886 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball, heating_up
3:01.186 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
3:01.628 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana fireball, hot_streak
3:02.792 standard_rotation x fireball Fluffy_Pillow 49106.0/50000: 98% mana heating_up
3:04.092 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:04.534 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
3:05.697 standard_rotation x fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
3:07.439 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:08.739 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:09.179 standard_rotation q pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak, firestorm
3:10.343 standard_rotation p pyroblast Fluffy_Pillow 49104.0/50000: 98% mana hot_streak, firestorm
3:11.503 standard_rotation p pyroblast Fluffy_Pillow 49264.0/50000: 99% mana heating_up, firestorm
3:12.665 standard_rotation p pyroblast Fluffy_Pillow 49426.0/50000: 99% mana hot_streak, firestorm
3:13.829 standard_rotation x fireball Fluffy_Pillow 49590.0/50000: 99% mana heating_up
3:15.572 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up
3:17.312 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
3:19.054 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
3:20.797 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
3:22.538 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:24.278 combustion_phase d fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
3:25.578 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
3:25.578 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power
3:26.019 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power
3:26.019 combustion_phase c phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, gladiators_badge
3:27.181 combustion_phase a pyroblast Fluffy_Pillow 45103.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:27.181 combustion_phase V fire_blast Fluffy_Pillow 44103.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
3:28.343 combustion_phase a pyroblast Fluffy_Pillow 44765.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:29.506 combustion_phase c phoenix_flames Fluffy_Pillow 44928.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:30.670 combustion_phase a pyroblast Fluffy_Pillow 46092.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:30.670 combustion_phase V fire_blast Fluffy_Pillow 45092.0/50000: 90% mana combustion, rune_of_power, gladiators_badge
3:31.834 combustion_phase a pyroblast Fluffy_Pillow 45756.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:32.997 combustion_phase e scorch Fluffy_Pillow 45919.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:34.158 combustion_phase b pyroblast Fluffy_Pillow 46580.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
3:35.332 combustion_phase e scorch Fluffy_Pillow 46754.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
3:36.495 combustion_phase b pyroblast Fluffy_Pillow 47417.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
3:37.668 default O rune_of_power Fluffy_Pillow 47590.0/50000: 95% mana heating_up, gladiators_badge
3:38.831 rop_phase o fireball Fluffy_Pillow 48753.0/50000: 98% mana heating_up, rune_of_power, gladiators_badge
3:40.131 rop_phase j fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power, gladiators_badge
3:40.573 rop_phase h pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, rune_of_power, gladiators_badge
3:41.735 rop_phase o fireball Fluffy_Pillow 49104.0/50000: 98% mana heating_up, rune_of_power
3:43.476 rop_phase o fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, rune_of_power
3:45.217 rop_phase n scorch Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
3:46.032 rop_phase i fire_blast Fluffy_Pillow 49804.0/50000: 100% mana fireball(2), rune_of_power
3:46.379 default N use_item_dreadfire_vessel Fluffy_Pillow 49166.0/50000: 98% mana fireball(2), heating_up, rune_of_power
3:46.379 rop_phase l pyroblast Fluffy_Pillow 49166.0/50000: 98% mana fireball(2), heating_up, rune_of_power
3:47.554 rop_phase g pyroblast Fluffy_Pillow 49341.0/50000: 99% mana fireball(2), heating_up, rune_of_power, firestorm
3:48.717 rop_phase g pyroblast Fluffy_Pillow 49504.0/50000: 99% mana fireball(2), hot_streak, rune_of_power, firestorm
3:49.879 rop_phase g pyroblast Fluffy_Pillow 49666.0/50000: 99% mana fireball(2), heating_up, rune_of_power, firestorm
3:51.042 standard_rotation r pyroblast Fluffy_Pillow 49829.0/50000: 100% mana fireball(2), hot_streak
3:52.204 standard_rotation u phoenix_flames Fluffy_Pillow 49991.0/50000: 100% mana fireball(2)
3:53.366 standard_rotation w scorch Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
3:53.753 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
3:54.530 standard_rotation t pyroblast Fluffy_Pillow 49506.0/50000: 99% mana fireball(2), heating_up
3:55.701 standard_rotation w scorch Fluffy_Pillow 49677.0/50000: 99% mana fireball(2), heating_up
3:56.864 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana fireball(2), heating_up
3:58.037 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana fireball(2)
3:59.200 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana fireball(2)
4:00.363 default M mirror_image Fluffy_Pillow 49505.0/50000: 99% mana fireball(2), heating_up
4:01.524 standard_rotation r pyroblast Fluffy_Pillow 49666.0/50000: 99% mana hot_streak
4:02.688 standard_rotation w scorch Fluffy_Pillow 49830.0/50000: 100% mana
4:02.688 standard_rotation s fire_blast Fluffy_Pillow 49830.0/50000: 100% mana
4:03.851 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:05.025 standard_rotation w scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:06.188 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:07.352 standard_rotation t pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:08.524 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:09.195 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
4:09.687 standard_rotation t pyroblast Fluffy_Pillow 49492.0/50000: 99% mana heating_up
4:10.859 standard_rotation w scorch Fluffy_Pillow 49664.0/50000: 99% mana
4:12.021 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:13.184 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:14.356 standard_rotation w scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:15.519 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:16.681 standard_rotation s fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:16.916 standard_rotation r pyroblast Fluffy_Pillow 49239.0/50000: 98% mana hot_streak
4:18.078 standard_rotation w scorch Fluffy_Pillow 49401.0/50000: 99% mana
4:19.241 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:20.405 standard_rotation t pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:21.575 standard_rotation w scorch Fluffy_Pillow 49676.0/50000: 99% mana
4:22.737 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:23.900 default O rune_of_power Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:25.063 rop_phase h pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power
4:25.063 rop_phase i fire_blast Fluffy_Pillow 49000.0/50000: 98% mana rune_of_power
4:26.225 rop_phase n scorch Fluffy_Pillow 49662.0/50000: 99% mana hot_streak, rune_of_power
4:27.387 rop_phase h pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak, rune_of_power
4:28.550 rop_phase n scorch Fluffy_Pillow 49667.0/50000: 99% mana hot_streak, rune_of_power
4:29.714 rop_phase h pyroblast Fluffy_Pillow 49506.0/50000: 99% mana hot_streak, rune_of_power
4:30.876 rop_phase n scorch Fluffy_Pillow 49668.0/50000: 99% mana hot_streak, rune_of_power
4:32.040 rop_phase h pyroblast Fluffy_Pillow 49506.0/50000: 99% mana hot_streak, rune_of_power
4:32.358 rop_phase j fire_blast Fluffy_Pillow 48806.0/50000: 98% mana heating_up, rune_of_power
4:33.202 rop_phase h pyroblast Fluffy_Pillow 49168.0/50000: 98% mana hot_streak, rune_of_power
4:34.367 rop_phase n scorch Fluffy_Pillow 49333.0/50000: 99% mana rune_of_power
4:35.528 rop_phase n scorch Fluffy_Pillow 49503.0/50000: 99% mana rune_of_power
4:36.688 rop_phase l pyroblast Fluffy_Pillow 49502.0/50000: 99% mana heating_up, rune_of_power
4:37.864 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up
4:39.028 standard_rotation t pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:40.199 combustion_phase Z pyroblast Fluffy_Pillow 49677.0/50000: 99% mana heating_up, firestorm
4:41.362 combustion_phase Z pyroblast Fluffy_Pillow 49840.0/50000: 100% mana hot_streak, firestorm
4:42.521 combustion_phase Z pyroblast Fluffy_Pillow 49999.0/50000: 100% mana heating_up, firestorm
4:43.683 combustion_phase d fireball Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:44.983 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:45.424 combustion_cooldowns T fireblood Fluffy_Pillow 44441.0/50000: 89% mana combustion, hot_streak, rune_of_power
4:45.424 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44441.0/50000: 89% mana fireblood, combustion, hot_streak, rune_of_power
4:45.424 combustion_phase a pyroblast Fluffy_Pillow 44441.0/50000: 89% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
4:46.588 combustion_phase a pyroblast Fluffy_Pillow 44605.0/50000: 89% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
4:46.588 combustion_phase V fire_blast Fluffy_Pillow 43605.0/50000: 87% mana fireblood, combustion, rune_of_power, gladiators_badge
4:47.752 combustion_phase a pyroblast Fluffy_Pillow 44269.0/50000: 89% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
4:47.852 combustion_phase V fire_blast Fluffy_Pillow 43369.0/50000: 87% mana fireblood, combustion, rune_of_power, gladiators_badge
4:48.915 combustion_phase a pyroblast Fluffy_Pillow 43932.0/50000: 88% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
4:50.077 combustion_phase c phoenix_flames Fluffy_Pillow 44094.0/50000: 88% mana fireblood, combustion, heating_up, rune_of_power, gladiators_badge
4:51.238 combustion_phase a pyroblast Fluffy_Pillow 45255.0/50000: 91% mana fireblood, combustion, hot_streak, rune_of_power, gladiators_badge
4:52.400 combustion_phase c phoenix_flames Fluffy_Pillow 45417.0/50000: 91% mana fireblood, combustion, heating_up, rune_of_power, gladiators_badge
4:53.562 combustion_phase a pyroblast Fluffy_Pillow 46579.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:54.723 combustion_phase e scorch Fluffy_Pillow 46740.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.523 combustion_phase V fire_blast Fluffy_Pillow 47540.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.885 combustion_phase a pyroblast Fluffy_Pillow 46902.0/50000: 94% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:57.048 standard_rotation p pyroblast Fluffy_Pillow 47065.0/50000: 94% mana hot_streak, firestorm, gladiators_badge
4:58.212 standard_rotation p pyroblast Fluffy_Pillow 47229.0/50000: 94% mana heating_up, firestorm, gladiators_badge
4:59.374 standard_rotation p pyroblast Fluffy_Pillow 47391.0/50000: 95% mana hot_streak, firestorm, gladiators_badge
5:00.537 standard_rotation w scorch Fluffy_Pillow 47554.0/50000: 95% mana heating_up
5:01.699 standard_rotation t pyroblast Fluffy_Pillow 48216.0/50000: 96% mana heating_up
5:02.873 standard_rotation u phoenix_flames Fluffy_Pillow 48390.0/50000: 97% mana
5:04.035 standard_rotation w scorch Fluffy_Pillow 49552.0/50000: 99% mana
5:04.035 standard_rotation s fire_blast Fluffy_Pillow 49552.0/50000: 99% mana
5:05.198 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
5:06.371 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana
5:07.534 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
5:08.696 standard_rotation t pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
5:09.868 default O rune_of_power Fluffy_Pillow 49676.0/50000: 99% mana heating_up, firestorm
5:10.963 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
5:11.220 rop_phase g pyroblast Fluffy_Pillow 49757.0/50000: 100% mana hot_streak, rune_of_power, firestorm
5:12.383 rop_phase g pyroblast Fluffy_Pillow 49920.0/50000: 100% mana heating_up, rune_of_power, firestorm
5:13.544 rop_phase h pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power
5:14.707 rop_phase n scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
5:15.869 rop_phase n scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
5:17.031 default N use_item_dreadfire_vessel Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:17.031 rop_phase l pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:18.205 rop_phase n scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, rune_of_power
5:19.367 rop_phase j fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:19.367 rop_phase h pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, rune_of_power

Stats

Level Bonus (60) Race Bonus (dark_iron_dwarf) Raid-Buffed Unbuffed Gear Amount
Strength 198 2 200 200 0
Agility 306 -2 304 304 0
Stamina 414 1 2019 1923 1508
Intellect 450 -1 1815 1634 1108 (132)
Spirit 0 0 0 0 0
Health 40380 38460 0
Mana 50000 50000 0
Spell Power 1815 1634 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="dark_iron_dwarf"
source=default
spec=fire
level=60
race=dark_iron_dwarf
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

draenei : 5117 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5116.8 5116.8 9.7 / 0.190% 813.5 / 15.9% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
798.6 793.8 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
draenei 5117
Conflagration Flare Up 24 0.5% 29.9 9.82sec 240 0 Direct 29.9 152 380 240 38.4%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.90 29.90 0.00 0.00 0.0000 0.0000 7167.02 7167.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.62% 18.42 6 34 152.21 132 257 152.19 134 180 2804 2804 0.00%
crit 38.38% 11.47 1 27 380.28 263 515 380.93 273 515 4363 4363 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 10 0.2% 0.8 116.09sec 3946 3395 Direct 0.8 0 3946 3946 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.78 0.78 0.00 0.00 1.1625 0.0000 3065.54 3065.54 0.00% 3394.84 3394.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.78 0 4 3945.51 3831 4443 2272.54 0 4443 3066 3066 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.78
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 158 3.1% 3.3 103.68sec 14398 0 Direct 3.3 11658 23314 14446 24.0%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.29 0.00 0.00 0.0000 0.0000 47539.10 47539.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.05% 2.50 0 4 11657.63 11342 12023 11520.46 0 12023 29169 29169 0.00%
crit 23.95% 0.79 0 4 23313.77 22685 24046 13810.63 0 24046 18370 18370 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 608 11.9% 42.3 7.15sec 4307 0 Direct 42.3 0 4307 4307 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.32 42.32 0.00 0.00 0.0000 0.0000 182260.09 182260.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.32 33 50 4307.18 3089 6042 4308.88 4035 4599 182260 182260 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.71
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:3.03
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.25
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.33
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 619 (647) 12.1% (12.6%) 77.1 3.42sec 2517 1514 Direct 77.1 (220.4) 1679 3496 2407 40.1% (40.1%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.14 77.14 0.00 0.00 1.6625 0.0000 185655.41 185655.41 0.00% 1514.05 1514.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.92% 46.22 22 66 1678.62 1458 2606 1678.89 1562 1801 77589 77589 0.00%
crit 40.08% 30.91 18 44 3495.60 2915 5702 3498.61 3262 3803 108067 108067 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.69
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.80
    standard_rotation
    [w]:51.71
    Conflagration 28 0.6% 77.1 3.42sec 111 0 Periodic 143.3 36 91 60 42.6% 69.0%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.14 0.00 143.30 143.30 0.0000 1.4471 8527.53 8527.53 0.00% 41.12 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.40% 82.26 53 109 36.03 0 58 36.02 34 38 2964 2964 0.00%
crit 42.60% 61.04 42 84 91.16 0 126 91.24 84 99 5564 5564 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 968 18.9% 264.9 1.13sec 1097 0 Periodic 299.2 971 0 971 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.86 0.00 299.20 299.20 0.0000 1.0000 290619.21 290619.21 0.00% 971.31 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 971.21 153 2953 972.51 848 1158 290619 290619 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.43sec 3697 4778

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7739 0.0000 0.00 0.00 0.00% 4777.73 4777.73

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 34 Direct 235.3 38 76 47 24.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.01 235.26 0.00 0.00 1.3988 0.0000 11060.44 11060.44 0.00% 33.50 33.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.62% 177.92 122 209 37.81 29 53 37.89 35 41 6728 6728 0.00%
crit 24.38% 57.35 29 82 75.53 58 107 75.70 66 88 4332 4332 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.70
Phoenix Flames 0 (245) 0.0% (4.8%) 14.1 21.75sec 5189 4714

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.12 0.00 0.00 0.00 1.1008 0.0000 0.00 0.00 0.00% 4713.93 4713.93

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.08
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.35
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.68
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 245 4.8% 14.1 21.71sec 5202 0 Direct 14.1 2126 6055 5205 78.3%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 0.00 0.00 0.0000 0.0000 73292.22 73292.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.69% 3.06 0 8 2126.03 1755 3433 2100.71 0 3433 6495 6495 0.00%
crit 78.31% 11.03 5 16 6055.09 3510 6865 6060.82 5273 6493 66797 66797 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2074 (2206) 40.5% (43.1%) 96.9 3.08sec 6830 6111 Direct 97.6 (275.7) 3125 7841 6375 68.9% (68.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.92 97.63 0.00 0.00 1.1177 0.0000 622285.54 622285.54 0.00% 6110.64 6110.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.09% 30.35 18 45 3124.50 2658 5199 3123.78 2858 3434 94815 94815 0.00%
crit 68.91% 67.28 39 113 7841.14 5315 10397 7866.31 7053 8964 527470 527470 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.14
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.36
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.28
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.99
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.38
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.38
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.72
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.49
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.30
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.85
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.6% 97.6 3.07sec 406 0 Periodic 178.1 138 353 223 39.5% 86.7%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.63 0.00 178.06 178.06 0.0000 1.4629 39680.23 39680.23 0.00% 152.33 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.50% 107.72 74 146 138.06 5 236 138.05 130 146 14872 14872 0.00%
crit 39.50% 70.34 47 100 352.68 10 473 353.20 330 383 24808 24808 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 214 4.2% 33.7 7.70sec 1908 1655 Direct 33.7 0 1908 1908 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.72 33.72 0.00 0.00 1.1529 0.0000 64331.86 64331.86 0.00% 1654.92 1654.92
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.72 18 52 1908.12 966 3376 1909.28 1712 2171 64332 64332 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.74
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:7.91
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.46
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
draenei
Combustion 4.7 70.81sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.67
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.19
Rune of Power 5.3 60.38sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 0.00 0.00 0.00 1.1119 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.33
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.7sec 70.7sec 11.8sec 18.40% 0.00% 105.7 (105.7) 4.5

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:51.0s / 89.8s
  • trigger_min/max:51.0s / 89.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • combustion_1:18.40%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.4 24.8 9.2sec 4.2sec 5.2sec 36.84% 0.00% 0.0 (0.0) 0.5

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 47.1s
  • trigger_min/max:1.3s / 43.6s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 29.5s

Stack Uptimes

  • fireball_1:20.53%
  • fireball_2:9.00%
  • fireball_3:4.52%
  • fireball_4:1.93%
  • fireball_5:0.66%
  • fireball_6:0.17%
  • fireball_7:0.04%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.9 36.5sec 32.3sec 4.2sec 11.02% 0.00% 0.9 (0.9) 7.7

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 152.0s
  • trigger_min/max:0.8s / 152.0s
  • trigger_pct:10.22%
  • duration_min/max:0.0s / 16.8s

Stack Uptimes

  • firestorm_1:11.02%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.2sec 72.8sec 14.7sec 22.90% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 89.7s
  • trigger_min/max:60.0s / 89.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.90%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.2 0.0 3.1sec 3.1sec 1.1sec 35.17% 46.75% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.2s
  • trigger_min/max:0.2s / 19.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • heating_up_1:35.17%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.5 0.0 3.6sec 3.6sec 0.6sec 13.09% 86.35% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 30.4s
  • trigger_min/max:0.6s / 30.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.4s

Stack Uptimes

  • hot_streak_1:13.09%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 307.3sec 0.0sec 23.7sec 9.39% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 358.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.39%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.1sec 11.9sec 38.88% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 71.6s
  • trigger_min/max:4.8s / 71.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • rune_of_power_1:38.88%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.2 70.0 125.0 3.1s 0.2s 19.2s
Heating Up removed 11.3 2.0 23.0 24.1s 0.9s 241.9s
Heating Up converted with Fire Blast 23.3 13.0 35.0 12.1s 0.6s 106.4s
Hot Streak procs 84.5 63.0 111.0 3.6s 0.6s 30.4s
Hot Streak spells used 264.9 211.0 319.0 1.1s 0.0s 5.4s
Hot Streak spell crits 185.3 138.0 239.0 1.6s 0.0s 18.5s
Hot Streak spell crits wasted 4.5 0.0 11.0 65.7s 0.1s 337.5s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.03% 9.32% 17.86% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3170.0001.5800.9490.0002.696
Rune of Power13.9730.00038.63576.30615.859129.328
Fire Blast0.0940.00018.0033.9731.30025.812
Dragon's Breath139.59445.620310.481286.788189.215359.850
Combustion2.2191.30014.50310.4335.72425.754
Phoenix Flames0.2040.00026.7812.8971.73826.781

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
draenei
mana_regen Mana 2179.16 238524.16 100.00% 109.46 61629.08 20.53%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.84 798.62 61624.4 48564.5 42263.0 50000.0
Usage Type Count Total Avg RPE APR
draenei
combustion Mana 4.7 23349.7 5000.0 5002.0 0.0
dragons_breath Mana 0.8 1553.4 2000.0 1999.4 2.0
fire_blast Mana 42.3 21158.4 500.0 500.0 8.6
fireball Mana 77.2 77167.9 1000.0 1000.3 2.5
mirror_image Mana 3.0 1991.9 665.8 665.8 5.6
pyroblast Mana 97.9 97899.6 1000.0 1010.1 6.8
scorch Mana 33.7 16851.4 500.0 499.8 3.8

Statistics & Data Analysis

Fight Length
draenei Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
draenei Damage Per Second
Count 1717
Mean 5116.80
Minimum 4552.18
Maximum 5910.45
Spread ( max - min ) 1358.27
Range [ ( max - min ) / 2 * 100% ] 13.27%
Standard Deviation 205.1274
5th Percentile 4808.29
95th Percentile 5488.61
( 95th Percentile - 5th Percentile ) 680.32
Mean Distribution
Standard Deviation 4.9504
95.00% Confidence Interval ( 5107.09 - 5126.50 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6174
0.1 Scale Factor Error with Delta=300 360
0.05 Scale Factor Error with Delta=300 1437
0.01 Scale Factor Error with Delta=300 35920
Priority Target DPS
draenei Priority Target Damage Per Second
Count 1717
Mean 5116.80
Minimum 4552.18
Maximum 5910.45
Spread ( max - min ) 1358.27
Range [ ( max - min ) / 2 * 100% ] 13.27%
Standard Deviation 205.1274
5th Percentile 4808.29
95th Percentile 5488.61
( 95th Percentile - 5th Percentile ) 680.32
Mean Distribution
Standard Deviation 4.9504
95.00% Confidence Interval ( 5107.09 - 5126.50 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6174
0.1 Scale Factor Error with Delta=300 360
0.05 Scale Factor Error with Delta=300 1437
0.01 Scale Factor Error with Delta=300 35920
DPS(e)
draenei Damage Per Second (Effective)
Count 1717
Mean 5116.80
Minimum 4552.18
Maximum 5910.45
Spread ( max - min ) 1358.27
Range [ ( max - min ) / 2 * 100% ] 13.27%
Damage
draenei Damage
Count 1717
Mean 1524423.74
Minimum 1179621.52
Maximum 2023094.69
Spread ( max - min ) 843473.17
Range [ ( max - min ) / 2 * 100% ] 27.67%
DTPS
draenei Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
draenei Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
draenei Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
draenei Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
draenei Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
draenei Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
draeneiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
draenei Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.33 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.19 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.66 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.71 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.67 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.14 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.36 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.28 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.08 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.69 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.74 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.78 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.99 pyroblast,if=buff.firestorm.react
g 9.38 pyroblast,if=buff.hot_streak.react
h 3.03 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.25 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.38 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.35 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 7.91 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.80 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.72 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.49 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.30 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.33 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.85 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.68 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.46 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.71 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUZUZbZbZUZdadaUOgnnnnNnnnignpwrpwrpwwwwwwwwrpwwwrpwwrpwwwwwpwcWTZZUZUZbZUZbZbOgnnnnghnnrpwwwrpwpwwrpwNwwrpwwwMwwrpwwwwwwoYYcWUTZZUZUZbZbZUZYOflnnnignnwrpwwwwwrpwwwwwwrpwwwwwOhnignignngnwcWUTbZbZUZdadabqvrsvvsvrqNvqvMqvrsOmkmmigmmkffifvsvvsvrsvvsvvsvrqvvsvvsvvsvvsvvsvcWUTZSZUZUZbZbZUYYOgmhkfffgm

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask draenei 50000.0/50000: 100% mana
Pre precombat 1 food draenei 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.742 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.637 combustion_phase Z pyroblast Fluffy_Pillow 44837.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.637 combustion_phase U fire_blast Fluffy_Pillow 43837.0/50000: 88% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.532 combustion_phase Z pyroblast Fluffy_Pillow 44232.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.532 combustion_phase U fire_blast Fluffy_Pillow 43232.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.425 combustion_phase Z pyroblast Fluffy_Pillow 43625.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.320 combustion_phase b phoenix_flames Fluffy_Pillow 43520.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.216 combustion_phase Z pyroblast Fluffy_Pillow 44416.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.112 combustion_phase b phoenix_flames Fluffy_Pillow 44312.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.007 combustion_phase Z pyroblast Fluffy_Pillow 45207.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.007 combustion_phase U fire_blast Fluffy_Pillow 44207.0/50000: 88% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.903 combustion_phase Z pyroblast Fluffy_Pillow 44603.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.797 combustion_phase d scorch Fluffy_Pillow 44497.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.692 combustion_phase a pyroblast Fluffy_Pillow 44892.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.597 combustion_phase d scorch Fluffy_Pillow 44797.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.493 combustion_phase a pyroblast Fluffy_Pillow 45193.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.202 combustion_phase U fire_blast Fluffy_Pillow 44902.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.396 default O rune_of_power Fluffy_Pillow 44596.0/50000: 89% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:14.293 rop_phase g pyroblast Fluffy_Pillow 45493.0/50000: 91% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.187 rop_phase n fireball Fluffy_Pillow 45387.0/50000: 91% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:16.527 rop_phase n fireball Fluffy_Pillow 45727.0/50000: 91% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.868 rop_phase n fireball Fluffy_Pillow 46068.0/50000: 92% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:19.209 rop_phase n fireball Fluffy_Pillow 46409.0/50000: 93% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:20.551 default N use_item_dreadfire_vessel Fluffy_Pillow 46751.0/50000: 94% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:20.551 rop_phase n fireball Fluffy_Pillow 46751.0/50000: 94% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:21.893 rop_phase n fireball Fluffy_Pillow 47093.0/50000: 94% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:23.233 rop_phase n fireball Fluffy_Pillow 47433.0/50000: 95% mana bloodlust, fireball(4), rune_of_power, potion_of_spectral_intellect
0:24.433 rop_phase i fire_blast Fluffy_Pillow 48633.0/50000: 97% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:24.573 rop_phase g pyroblast Fluffy_Pillow 47273.0/50000: 95% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:25.468 rop_phase n fireball Fluffy_Pillow 47168.0/50000: 94% mana bloodlust, hot_streak, rune_of_power
0:26.808 standard_rotation p pyroblast Fluffy_Pillow 47508.0/50000: 95% mana bloodlust, hot_streak
0:27.703 standard_rotation w fireball Fluffy_Pillow 47403.0/50000: 95% mana bloodlust, heating_up
0:28.703 standard_rotation r fire_blast Fluffy_Pillow 48403.0/50000: 97% mana bloodlust, heating_up
0:29.041 standard_rotation p pyroblast Fluffy_Pillow 47241.0/50000: 94% mana bloodlust, hot_streak
0:29.935 standard_rotation w fireball Fluffy_Pillow 47135.0/50000: 94% mana bloodlust, fireball, heating_up
0:30.996 standard_rotation r fire_blast Fluffy_Pillow 48135.0/50000: 96% mana bloodlust, fireball, heating_up
0:31.275 standard_rotation p pyroblast Fluffy_Pillow 46975.0/50000: 94% mana bloodlust, fireball, hot_streak
0:32.169 standard_rotation w fireball Fluffy_Pillow 46869.0/50000: 94% mana bloodlust, fireball(2)
0:33.510 standard_rotation w fireball Fluffy_Pillow 47210.0/50000: 94% mana bloodlust, fireball(2)
0:34.851 standard_rotation w fireball Fluffy_Pillow 47551.0/50000: 95% mana bloodlust, fireball(3)
0:36.192 standard_rotation w fireball Fluffy_Pillow 47892.0/50000: 96% mana bloodlust, heating_up
0:37.532 standard_rotation w fireball Fluffy_Pillow 48232.0/50000: 96% mana bloodlust, fireball
0:38.874 standard_rotation w fireball Fluffy_Pillow 48574.0/50000: 97% mana bloodlust, fireball(2)
0:40.214 standard_rotation w fireball Fluffy_Pillow 48914.0/50000: 98% mana bloodlust, fireball(3)
0:41.554 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
0:42.854 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:43.295 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
0:44.457 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
0:46.198 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
0:47.938 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
0:49.538 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:49.681 standard_rotation p pyroblast Fluffy_Pillow 48643.0/50000: 97% mana hot_streak
0:50.842 standard_rotation w fireball Fluffy_Pillow 48804.0/50000: 98% mana fireball
0:52.583 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
0:53.883 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:54.326 standard_rotation p pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak
0:55.489 standard_rotation w fireball Fluffy_Pillow 49106.0/50000: 98% mana heating_up
0:57.229 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana heating_up
0:58.971 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:00.712 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:02.455 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up
1:04.197 standard_rotation p pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
1:05.361 standard_rotation w fireball Fluffy_Pillow 49169.0/50000: 98% mana heating_up
1:07.102 combustion_phase c fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
1:08.402 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
1:08.845 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44443.0/50000: 89% mana combustion, hot_streak, rune_of_power
1:08.845 combustion_phase Z pyroblast Fluffy_Pillow 44443.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:10.006 combustion_phase Z pyroblast Fluffy_Pillow 44604.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:10.006 combustion_phase U fire_blast Fluffy_Pillow 43604.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:11.170 combustion_phase Z pyroblast Fluffy_Pillow 44268.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:11.170 combustion_phase U fire_blast Fluffy_Pillow 43268.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:12.330 combustion_phase Z pyroblast Fluffy_Pillow 43928.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:13.493 combustion_phase b phoenix_flames Fluffy_Pillow 44091.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.656 combustion_phase Z pyroblast Fluffy_Pillow 45254.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:14.656 combustion_phase U fire_blast Fluffy_Pillow 44254.0/50000: 89% mana combustion, rune_of_power, gladiators_badge
1:15.820 combustion_phase Z pyroblast Fluffy_Pillow 44918.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:16.983 combustion_phase b phoenix_flames Fluffy_Pillow 45081.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
1:18.146 combustion_phase Z pyroblast Fluffy_Pillow 46244.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:19.309 combustion_phase b phoenix_flames Fluffy_Pillow 46407.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:20.472 default O rune_of_power Fluffy_Pillow 47570.0/50000: 95% mana hot_streak, gladiators_badge
1:21.637 rop_phase g pyroblast Fluffy_Pillow 48735.0/50000: 97% mana hot_streak, rune_of_power, gladiators_badge
1:22.799 rop_phase n fireball Fluffy_Pillow 48897.0/50000: 98% mana rune_of_power, gladiators_badge
1:24.542 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana rune_of_power
1:26.283 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
1:28.024 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, rune_of_power
1:29.765 rop_phase g pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, rune_of_power
1:29.765 rop_phase h fire_blast Fluffy_Pillow 48004.0/50000: 96% mana rune_of_power
1:30.928 rop_phase n fireball Fluffy_Pillow 48667.0/50000: 97% mana fireball, rune_of_power
1:32.669 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
1:33.969 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:34.410 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:35.570 standard_rotation w fireball Fluffy_Pillow 49101.0/50000: 98% mana fireball
1:37.313 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
1:39.054 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:40.354 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:40.795 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:41.957 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana hot_streak
1:43.700 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
1:44.862 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball
1:46.604 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:47.904 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:48.348 standard_rotation p pyroblast Fluffy_Pillow 48944.0/50000: 98% mana hot_streak
1:49.511 standard_rotation w fireball Fluffy_Pillow 49107.0/50000: 98% mana fireball
1:51.253 default N use_item_dreadfire_vessel Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:51.253 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:52.993 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
1:54.693 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:54.736 standard_rotation p pyroblast Fluffy_Pillow 48543.0/50000: 97% mana hot_streak
1:55.898 standard_rotation w fireball Fluffy_Pillow 48705.0/50000: 97% mana fireball
1:57.637 standard_rotation w fireball Fluffy_Pillow 49002.0/50000: 98% mana fireball
1:59.378 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:01.119 default M mirror_image Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:02.281 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball(2)
2:04.022 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:05.322 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:05.764 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:06.927 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana heating_up
2:08.669 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:10.410 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:12.152 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:13.893 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
2:15.634 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:17.374 standard_rotation o pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak, firestorm
2:18.536 combustion_phase Y pyroblast Fluffy_Pillow 49165.0/50000: 98% mana fireball, heating_up, firestorm
2:19.697 combustion_phase Y pyroblast Fluffy_Pillow 49326.0/50000: 99% mana fireball, hot_streak, firestorm
2:20.859 combustion_phase c fireball Fluffy_Pillow 49488.0/50000: 99% mana fireball, heating_up
2:22.159 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
2:22.159 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, heating_up, rune_of_power
2:22.599 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball, hot_streak, rune_of_power
2:22.599 combustion_phase Z pyroblast Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball, hot_streak, rune_of_power, gladiators_badge
2:23.761 combustion_phase Z pyroblast Fluffy_Pillow 44102.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.761 combustion_phase U fire_blast Fluffy_Pillow 43102.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
2:24.922 combustion_phase Z pyroblast Fluffy_Pillow 43763.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:24.922 combustion_phase U fire_blast Fluffy_Pillow 42763.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
2:26.086 combustion_phase Z pyroblast Fluffy_Pillow 43427.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:27.248 combustion_phase b phoenix_flames Fluffy_Pillow 43589.0/50000: 87% mana combustion, heating_up, rune_of_power, gladiators_badge
2:28.410 combustion_phase Z pyroblast Fluffy_Pillow 44751.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:29.573 combustion_phase b phoenix_flames Fluffy_Pillow 44914.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
2:30.736 combustion_phase Z pyroblast Fluffy_Pillow 46077.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:31.536 combustion_phase U fire_blast Fluffy_Pillow 45877.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:31.899 combustion_phase Z pyroblast Fluffy_Pillow 45740.0/50000: 91% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:33.062 combustion_phase Y pyroblast Fluffy_Pillow 45903.0/50000: 92% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
2:34.226 default O rune_of_power Fluffy_Pillow 46067.0/50000: 92% mana hot_streak, firestorm, gladiators_badge
2:35.389 rop_phase f pyroblast Fluffy_Pillow 47230.0/50000: 94% mana hot_streak, rune_of_power, firestorm, gladiators_badge
2:36.551 rop_phase l phoenix_flames Fluffy_Pillow 47392.0/50000: 95% mana heating_up, rune_of_power, gladiators_badge
2:37.713 rop_phase n fireball Fluffy_Pillow 48554.0/50000: 97% mana rune_of_power
2:39.454 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana rune_of_power
2:41.197 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, rune_of_power
2:42.497 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
2:42.937 rop_phase g pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak, rune_of_power
2:44.099 rop_phase n fireball Fluffy_Pillow 49102.0/50000: 98% mana fireball, rune_of_power
2:45.840 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
2:47.582 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:48.982 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:49.324 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak
2:50.488 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, heating_up
2:52.228 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball, heating_up
2:53.971 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
2:55.714 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(3)
2:57.455 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
2:59.155 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:59.195 standard_rotation p pyroblast Fluffy_Pillow 48540.0/50000: 97% mana hot_streak
3:00.359 standard_rotation w fireball Fluffy_Pillow 48704.0/50000: 97% mana fireball
3:02.099 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
3:03.838 standard_rotation w fireball Fluffy_Pillow 49002.0/50000: 98% mana fireball(2)
3:05.579 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:07.322 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
3:09.065 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
3:10.565 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:10.807 standard_rotation p pyroblast Fluffy_Pillow 48742.0/50000: 97% mana hot_streak
3:11.969 standard_rotation w fireball Fluffy_Pillow 48904.0/50000: 98% mana fireball
3:13.711 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:15.454 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
3:17.194 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
3:18.935 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
3:20.678 default O rune_of_power Fluffy_Pillow 49006.0/50000: 98% mana fireball(5)
3:21.840 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(6), rune_of_power
3:21.840 rop_phase n fireball Fluffy_Pillow 49500.0/50000: 99% mana fireball(6), heating_up, rune_of_power
3:23.140 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(6), heating_up, rune_of_power
3:23.581 rop_phase g pyroblast Fluffy_Pillow 48941.0/50000: 98% mana fireball(6), hot_streak, rune_of_power
3:24.745 rop_phase n fireball Fluffy_Pillow 49105.0/50000: 98% mana heating_up, rune_of_power
3:26.045 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
3:26.489 rop_phase g pyroblast Fluffy_Pillow 48944.0/50000: 98% mana hot_streak, rune_of_power
3:27.652 rop_phase n fireball Fluffy_Pillow 49107.0/50000: 98% mana heating_up, rune_of_power
3:29.393 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, rune_of_power
3:31.134 rop_phase g pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, rune_of_power
3:32.296 rop_phase n fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball, rune_of_power
3:34.037 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
3:35.781 combustion_phase c fireball Fluffy_Pillow 49007.0/50000: 98% mana heating_up
3:37.081 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball
3:37.081 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power
3:37.522 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power
3:37.522 combustion_phase b phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, gladiators_badge
3:38.684 combustion_phase Z pyroblast Fluffy_Pillow 45103.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:39.846 combustion_phase b phoenix_flames Fluffy_Pillow 45265.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
3:41.008 combustion_phase Z pyroblast Fluffy_Pillow 46427.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:41.108 combustion_phase U fire_blast Fluffy_Pillow 45527.0/50000: 91% mana combustion, rune_of_power, gladiators_badge
3:42.170 combustion_phase Z pyroblast Fluffy_Pillow 46089.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:43.331 combustion_phase d scorch Fluffy_Pillow 46250.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:44.493 combustion_phase a pyroblast Fluffy_Pillow 46912.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
3:45.668 combustion_phase d scorch Fluffy_Pillow 47087.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
3:46.831 combustion_phase a pyroblast Fluffy_Pillow 47750.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
3:48.002 combustion_phase b phoenix_flames Fluffy_Pillow 47921.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
3:49.165 standard_rotation q pyroblast Fluffy_Pillow 49084.0/50000: 98% mana hot_streak, gladiators_badge
3:50.328 standard_rotation v scorch Fluffy_Pillow 49247.0/50000: 98% mana gladiators_badge
3:50.328 standard_rotation r fire_blast Fluffy_Pillow 49247.0/50000: 98% mana gladiators_badge
3:51.489 standard_rotation s pyroblast Fluffy_Pillow 49408.0/50000: 99% mana heating_up, gladiators_badge
3:52.664 standard_rotation v scorch Fluffy_Pillow 49583.0/50000: 99% mana
3:53.828 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
3:54.991 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
3:56.165 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana heating_up
3:56.460 standard_rotation r fire_blast Fluffy_Pillow 49879.0/50000: 100% mana heating_up
3:57.328 standard_rotation q pyroblast Fluffy_Pillow 49505.0/50000: 99% mana hot_streak
3:58.491 default N use_item_dreadfire_vessel Fluffy_Pillow 49668.0/50000: 99% mana hot_streak
3:58.491 standard_rotation v scorch Fluffy_Pillow 49668.0/50000: 99% mana hot_streak
3:59.653 standard_rotation q pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak
4:00.817 standard_rotation v scorch Fluffy_Pillow 49668.0/50000: 99% mana hot_streak
4:01.981 default M mirror_image Fluffy_Pillow 49506.0/50000: 99% mana hot_streak
4:03.143 standard_rotation q pyroblast Fluffy_Pillow 49668.0/50000: 99% mana hot_streak
4:04.305 standard_rotation v scorch Fluffy_Pillow 49830.0/50000: 100% mana
4:04.305 standard_rotation r fire_blast Fluffy_Pillow 49830.0/50000: 100% mana
4:05.469 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:06.640 default O rune_of_power Fluffy_Pillow 49677.0/50000: 99% mana heating_up
4:07.997 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
4:09.161 rop_phase k pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
4:10.333 rop_phase m scorch Fluffy_Pillow 49678.0/50000: 99% mana rune_of_power
4:11.494 rop_phase m scorch Fluffy_Pillow 49503.0/50000: 99% mana rune_of_power
4:12.657 rop_phase i fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
4:12.657 rop_phase g pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak, rune_of_power
4:13.819 rop_phase m scorch Fluffy_Pillow 49167.0/50000: 98% mana rune_of_power
4:14.982 rop_phase m scorch Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power
4:16.145 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
4:17.319 rop_phase f pyroblast Fluffy_Pillow 49679.0/50000: 99% mana heating_up, rune_of_power, firestorm
4:18.479 rop_phase f pyroblast Fluffy_Pillow 49839.0/50000: 100% mana hot_streak, rune_of_power, firestorm
4:19.623 rop_phase i fire_blast Fluffy_Pillow 49939.0/50000: 100% mana heating_up, rune_of_power, firestorm
4:19.640 rop_phase f pyroblast Fluffy_Pillow 49500.0/50000: 99% mana hot_streak, rune_of_power, firestorm
4:20.803 standard_rotation v scorch Fluffy_Pillow 49663.0/50000: 99% mana heating_up
4:21.964 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:23.139 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:24.300 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:25.463 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:26.634 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana
4:27.344 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
4:27.798 standard_rotation s pyroblast Fluffy_Pillow 49454.0/50000: 99% mana heating_up
4:28.969 standard_rotation v scorch Fluffy_Pillow 49625.0/50000: 99% mana
4:30.132 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:31.294 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:32.469 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:33.632 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:34.795 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:35.967 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up
4:35.967 standard_rotation r fire_blast Fluffy_Pillow 49677.0/50000: 99% mana heating_up
4:37.130 standard_rotation q pyroblast Fluffy_Pillow 49505.0/50000: 99% mana hot_streak
4:38.292 standard_rotation v scorch Fluffy_Pillow 49667.0/50000: 99% mana
4:39.455 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:40.619 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:41.790 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:42.954 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
4:44.118 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:45.289 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:46.452 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:47.614 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:48.788 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:49.950 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:51.112 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:52.285 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:53.448 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:54.613 standard_rotation s pyroblast Fluffy_Pillow 49507.0/50000: 99% mana heating_up
4:55.784 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:56.947 combustion_phase c fireball Fluffy_Pillow 49505.0/50000: 99% mana
4:58.247 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:58.247 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power
4:58.689 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power
4:58.689 combustion_phase Z pyroblast Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:59.852 combustion_cooldowns S potion Fluffy_Pillow 44105.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
5:00.000 combustion_phase Z pyroblast Fluffy_Pillow 44253.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:00.000 combustion_phase U fire_blast Fluffy_Pillow 43253.0/50000: 87% mana combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:01.161 combustion_phase Z pyroblast Fluffy_Pillow 43914.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:01.161 combustion_phase U fire_blast Fluffy_Pillow 42914.0/50000: 86% mana combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:02.324 combustion_phase Z pyroblast Fluffy_Pillow 43577.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:03.488 combustion_phase b phoenix_flames Fluffy_Pillow 43741.0/50000: 87% mana combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:04.649 combustion_phase Z pyroblast Fluffy_Pillow 44902.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:05.811 combustion_phase b phoenix_flames Fluffy_Pillow 45064.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:06.973 combustion_phase Z pyroblast Fluffy_Pillow 46226.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
5:06.973 combustion_phase U fire_blast Fluffy_Pillow 45226.0/50000: 90% mana combustion, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
5:08.136 combustion_phase Y pyroblast Fluffy_Pillow 45889.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
5:09.298 combustion_phase Y pyroblast Fluffy_Pillow 46051.0/50000: 92% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
5:10.462 default O rune_of_power Fluffy_Pillow 46215.0/50000: 92% mana hot_streak, gladiators_badge, potion_of_spectral_intellect
5:11.623 rop_phase g pyroblast Fluffy_Pillow 47376.0/50000: 95% mana hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:12.787 rop_phase m scorch Fluffy_Pillow 47540.0/50000: 95% mana rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:13.690 rop_phase h fire_blast Fluffy_Pillow 48440.0/50000: 97% mana rune_of_power, potion_of_spectral_intellect
5:13.949 rop_phase k pyroblast Fluffy_Pillow 47702.0/50000: 95% mana heating_up, rune_of_power, potion_of_spectral_intellect
5:15.123 rop_phase f pyroblast Fluffy_Pillow 47876.0/50000: 96% mana heating_up, rune_of_power, firestorm, potion_of_spectral_intellect
5:16.284 rop_phase f pyroblast Fluffy_Pillow 48037.0/50000: 96% mana hot_streak, rune_of_power, firestorm, potion_of_spectral_intellect
5:17.448 rop_phase f pyroblast Fluffy_Pillow 48201.0/50000: 96% mana heating_up, rune_of_power, firestorm, potion_of_spectral_intellect
5:18.610 rop_phase g pyroblast Fluffy_Pillow 48363.0/50000: 97% mana hot_streak, rune_of_power, potion_of_spectral_intellect
5:19.772 rop_phase m scorch Fluffy_Pillow 48525.0/50000: 97% mana rune_of_power, potion_of_spectral_intellect

Stats

Level Bonus (60) Race Bonus (draenei) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 222 222 0
Agility 306 -3 326 326 0
Stamina 414 2 2020 1924 1508
Intellect 450 0 1842 1660 1108 (132)
Spirit 0 0 0 0 0
Health 40400 38480 0
Mana 50000 50000 0
Spell Power 1842 1660 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="draenei"
source=default
spec=fire
level=60
race=draenei
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

dwarf : 5129 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5129.1 5129.1 9.6 / 0.188% 778.6 / 15.2% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
798.4 793.6 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
dwarf 5129
Conflagration Flare Up 24 0.5% 30.1 9.72sec 240 0 Direct 30.1 150 382 239 38.5%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.06 30.06 0.00 0.00 0.0000 0.0000 7198.56 7198.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.50% 18.48 5 37 149.95 130 255 149.96 131 180 2771 2771 0.00%
crit 38.50% 11.57 2 23 382.50 265 520 383.26 292 481 4427 4427 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.8 104.42sec 3977 3422 Direct 0.8 0 3977 3977 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.81 0.81 0.00 0.00 1.1625 0.0000 3240.21 3240.21 0.00% 3421.55 3421.55
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.81 0 4 3976.72 3860 4484 2367.61 0 4484 3240 3240 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.81
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 160 3.1% 3.3 103.84sec 14603 0 Direct 3.3 11655 23796 14678 24.9%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.29 3.28 0.00 0.00 0.0000 0.0000 48111.99 48111.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.13% 2.46 0 4 11654.83 11342 12023 11520.16 0 12023 28712 28712 0.00%
crit 24.87% 0.82 0 4 23796.18 23138 24527 14521.64 0 24527 19400 19400 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 611 11.9% 42.3 7.14sec 4334 0 Direct 42.3 0 4335 4335 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.32 42.32 0.00 0.00 0.0000 0.0000 183406.04 183406.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.32 34 50 4334.62 3104 6096 4336.22 4114 4590 183406 183406 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.77
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:3.00
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.20
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.34
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 617 (646) 12.0% (12.6%) 77.3 3.42sec 2507 1508 Direct 77.3 (220.7) 1655 3511 2397 40.0% (40.0%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.29 77.28 0.00 0.00 1.6626 0.0000 185242.30 185242.30 0.00% 1508.04 1508.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.02% 46.38 25 66 1654.78 1436 2574 1655.44 1528 1802 76759 76759 0.00%
crit 39.98% 30.90 17 45 3511.06 2930 5754 3514.43 3220 3789 108484 108484 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.69
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.78
    standard_rotation
    [w]:51.84
    Conflagration 28 0.6% 77.3 3.41sec 111 0 Periodic 143.4 35 92 60 42.9% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.28 0.00 143.41 143.41 0.0000 1.4470 8542.15 8542.15 0.00% 41.16 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.12% 81.92 53 113 35.49 0 57 35.48 33 38 2907 2907 0.00%
crit 42.88% 61.49 42 90 91.64 0 127 91.74 84 100 5635 5635 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 971 18.9% 264.7 1.13sec 1101 0 Periodic 299.2 974 0 974 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.73 0.00 299.21 299.21 0.0000 1.0000 291352.32 291352.32 0.00% 973.75 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.21 239 359 973.81 154 2971 974.96 845 1155 291352 291352 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.36sec 3678 4755

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7739 0.0000 0.00 0.00 0.00% 4754.96 4754.96

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 33 Direct 235.2 37 76 47 24.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.00 235.25 0.00 0.00 1.3988 0.0000 11002.98 11002.98 0.00% 33.33 33.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.56% 177.76 117 207 37.29 29 53 37.38 35 41 6630 6630 0.00%
crit 24.44% 57.49 31 88 76.06 58 108 76.21 67 87 4373 4373 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.70
Phoenix Flames 0 (247) 0.0% (4.8%) 14.1 21.70sec 5235 4754

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.13 0.00 0.00 0.00 1.1012 0.0000 0.00 0.00 0.00% 4754.15 4754.15

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.12
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.35
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.66
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 247 4.8% 14.1 21.73sec 5248 0 Direct 14.1 2103 6093 5249 78.8%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 0.00 0.00 0.0000 0.0000 73988.81 73988.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.18% 2.99 0 8 2103.23 1729 3396 2058.49 0 3396 6282 6282 0.00%
crit 78.82% 11.11 5 16 6092.63 3527 6928 6099.81 5232 6549 67707 67707 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2075 (2207) 40.5% (43.0%) 96.6 3.11sec 6856 6135 Direct 97.3 (275.0) 3079 7894 6401 69.0% (69.0%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.59 97.29 0.00 0.00 1.1175 0.0000 622641.94 622641.94 0.00% 6135.17 6135.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.02% 30.18 15 43 3078.54 2619 5143 3078.14 2787 3365 92911 92911 0.00%
crit 68.98% 67.11 41 117 7893.82 5342 10492 7918.27 7098 9003 529731 529731 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:6.91
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.41
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.31
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.97
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.30
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.41
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.70
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.48
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.28
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.83
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.6% 97.3 3.10sec 407 0 Periodic 177.7 136 356 223 39.5% 86.5%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.29 0.00 177.68 177.68 0.0000 1.4625 39575.87 39575.87 0.00% 152.30 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.49% 107.47 72 146 135.96 5 234 135.97 128 144 14612 14612 0.00%
crit 39.51% 70.21 48 104 355.59 10 477 356.13 331 388 24963 24963 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 215 4.2% 33.8 7.42sec 1921 1666 Direct 33.8 0 1921 1921 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.79 33.78 0.00 0.00 1.1531 0.0000 64891.63 64891.63 0.00% 1665.68 1665.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.78 17 50 1921.19 1030 3406 1921.98 1714 2178 64892 64892 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.80
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:8.01
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.37
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
dwarf
Combustion 4.7 70.94sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.67
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.20
Rune of Power 5.3 60.28sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 0.00 0.00 0.00 1.1119 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.32
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.7sec 70.7sec 11.8sec 18.42% 0.00% 105.8 (105.8) 4.5

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:48.6s / 89.4s
  • trigger_min/max:48.6s / 89.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.42%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.5 24.9 9.2sec 4.2sec 5.1sec 36.80% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 44.8s
  • trigger_min/max:1.3s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 30.1s

Stack Uptimes

  • fireball_1:20.55%
  • fireball_2:9.08%
  • fireball_3:4.36%
  • fireball_4:1.93%
  • fireball_5:0.68%
  • fireball_6:0.18%
  • fireball_7:0.03%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.8 36.4sec 32.5sec 4.2sec 10.91% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 159.7s
  • trigger_min/max:0.8s / 159.7s
  • trigger_pct:10.10%
  • duration_min/max:0.0s / 13.1s

Stack Uptimes

  • firestorm_1:10.91%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.2sec 72.8sec 14.7sec 22.93% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 89.4s
  • trigger_min/max:60.0s / 89.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.93%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.2 0.0 3.1sec 3.1sec 1.1sec 35.20% 46.72% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 20.2s
  • trigger_min/max:0.2s / 20.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s

Stack Uptimes

  • heating_up_1:35.20%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.4 0.0 3.6sec 3.6sec 0.6sec 13.06% 86.50% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 35.4s
  • trigger_min/max:0.5s / 35.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.5s

Stack Uptimes

  • hot_streak_1:13.06%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 309.0sec 0.0sec 23.6sec 9.41% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 358.5s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.41%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.1sec 12.0sec 38.91% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 72.9s
  • trigger_min/max:6.0s / 72.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • rune_of_power_1:38.91%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.2 71.0 124.0 3.1s 0.2s 20.2s
Heating Up removed 11.5 3.0 24.0 23.5s 0.9s 209.0s
Heating Up converted with Fire Blast 23.3 14.0 36.0 12.1s 0.5s 88.9s
Hot Streak procs 84.4 63.0 118.0 3.6s 0.5s 35.4s
Hot Streak spells used 264.8 211.0 320.0 1.1s 0.0s 6.3s
Hot Streak spell crits 185.2 139.0 246.0 1.6s 0.0s 17.9s
Hot Streak spell crits wasted 4.6 0.0 12.0 64.6s 0.1s 319.1s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.03% 9.44% 18.40% 0.5s 0.0s 4.2s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3170.00012.3070.9500.00012.652
Rune of Power13.9470.00038.18076.01516.087129.263
Fire Blast0.0950.00019.2694.0221.30028.515
Dragon's Breath136.15146.586308.785286.163202.462359.785
Combustion2.2051.30013.33710.3515.62923.343
Phoenix Flames0.2110.00028.1193.0071.73928.180

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
dwarf
mana_regen Mana 2173.83 238463.06 100.00% 109.70 61681.77 20.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.60 798.39 61690.4 48559.5 42266.0 50000.0
Usage Type Count Total Avg RPE APR
dwarf
combustion Mana 4.7 23367.0 5000.0 5003.3 0.0
dragons_breath Mana 0.8 1628.4 2000.0 1998.5 2.0
fire_blast Mana 42.3 21154.9 500.0 499.9 8.7
fireball Mana 77.3 77289.1 1000.0 1000.0 2.5
mirror_image Mana 3.0 1991.3 665.7 665.7 5.5
pyroblast Mana 97.6 97599.5 1000.0 1010.5 6.8
scorch Mana 33.8 16890.1 500.0 499.9 3.8

Statistics & Data Analysis

Fight Length
dwarf Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
dwarf Damage Per Second
Count 1717
Mean 5129.07
Minimum 4537.84
Maximum 5894.76
Spread ( max - min ) 1356.92
Range [ ( max - min ) / 2 * 100% ] 13.23%
Standard Deviation 203.9219
5th Percentile 4813.60
95th Percentile 5479.72
( 95th Percentile - 5th Percentile ) 666.13
Mean Distribution
Standard Deviation 4.9213
95.00% Confidence Interval ( 5119.42 - 5138.71 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6073
0.1 Scale Factor Error with Delta=300 355
0.05 Scale Factor Error with Delta=300 1420
0.01 Scale Factor Error with Delta=300 35499
Priority Target DPS
dwarf Priority Target Damage Per Second
Count 1717
Mean 5129.07
Minimum 4537.84
Maximum 5894.76
Spread ( max - min ) 1356.92
Range [ ( max - min ) / 2 * 100% ] 13.23%
Standard Deviation 203.9219
5th Percentile 4813.60
95th Percentile 5479.72
( 95th Percentile - 5th Percentile ) 666.13
Mean Distribution
Standard Deviation 4.9213
95.00% Confidence Interval ( 5119.42 - 5138.71 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6073
0.1 Scale Factor Error with Delta=300 355
0.05 Scale Factor Error with Delta=300 1420
0.01 Scale Factor Error with Delta=300 35499
DPS(e)
dwarf Damage Per Second (Effective)
Count 1717
Mean 5129.07
Minimum 4537.84
Maximum 5894.76
Spread ( max - min ) 1356.92
Range [ ( max - min ) / 2 * 100% ] 13.23%
Damage
dwarf Damage
Count 1717
Mean 1528191.83
Minimum 1182000.34
Maximum 2047646.45
Spread ( max - min ) 865646.11
Range [ ( max - min ) / 2 * 100% ] 28.32%
DTPS
dwarf Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
dwarf Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
dwarf Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
dwarf Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
dwarf Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
dwarf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
dwarfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
dwarf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.29 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.32 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.20 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.67 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.77 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.67 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 6.91 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.41 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.31 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.12 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.69 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.80 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.81 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.97 pyroblast,if=buff.firestorm.react
g 9.30 pyroblast,if=buff.hot_streak.react
h 3.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.20 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.41 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.35 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 8.01 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.78 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.70 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.48 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.28 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.34 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.83 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.66 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.37 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.84 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUZZUZUZbZbZUZbZdaUOgnnnnNnnnnhigwpwwwwwrpwrpooooooowoowrpooocWZZUTZUZbZbZUZeOnnnigffffgtwwrpwwwrpwwwrpwwwwrpwpwwwpwMwwwcWUTbZUZUZbZYYUZeOnnnignNnnigwtwwwwrpooowpwwrpwpwwwwrpwpwwwwcWUTZZUZUZbZbZUZeOnnnnnignnhvvqvrsvvsvvsvrsNvMvstvrsvvsvrsooOmkhmkmkmmkhmkvsvacWUTbZbZdaUZdaevsvrqvvsooroooOmkhlgmmkmffhgvv

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask dwarf 50000.0/50000: 100% mana
Pre precombat 1 food dwarf 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, heating_up, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.740 combustion_phase Z pyroblast Fluffy_Pillow 43940.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.635 combustion_phase Z pyroblast Fluffy_Pillow 43835.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.635 combustion_phase U fire_blast Fluffy_Pillow 42835.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.530 combustion_phase Z pyroblast Fluffy_Pillow 43230.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.530 combustion_phase U fire_blast Fluffy_Pillow 42230.0/50000: 84% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.426 combustion_phase Z pyroblast Fluffy_Pillow 42626.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.320 combustion_phase b phoenix_flames Fluffy_Pillow 42520.0/50000: 85% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.214 combustion_phase Z pyroblast Fluffy_Pillow 43414.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.109 combustion_phase b phoenix_flames Fluffy_Pillow 43309.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.004 combustion_phase Z pyroblast Fluffy_Pillow 44204.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.004 combustion_phase U fire_blast Fluffy_Pillow 43204.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.898 combustion_phase Z pyroblast Fluffy_Pillow 43598.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.792 combustion_phase b phoenix_flames Fluffy_Pillow 43492.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.686 combustion_phase Z pyroblast Fluffy_Pillow 44386.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.580 combustion_phase d scorch Fluffy_Pillow 44280.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.473 combustion_phase a pyroblast Fluffy_Pillow 44673.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.185 combustion_phase U fire_blast Fluffy_Pillow 44385.0/50000: 89% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.379 default O rune_of_power Fluffy_Pillow 44079.0/50000: 88% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:14.272 rop_phase g pyroblast Fluffy_Pillow 44972.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.166 rop_phase n fireball Fluffy_Pillow 44866.0/50000: 90% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:16.506 rop_phase n fireball Fluffy_Pillow 45206.0/50000: 90% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.847 rop_phase n fireball Fluffy_Pillow 45547.0/50000: 91% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:19.189 rop_phase n fireball Fluffy_Pillow 45889.0/50000: 92% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:20.529 default N use_item_dreadfire_vessel Fluffy_Pillow 46229.0/50000: 92% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:20.529 rop_phase n fireball Fluffy_Pillow 46229.0/50000: 92% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:21.869 rop_phase n fireball Fluffy_Pillow 46569.0/50000: 93% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:23.209 rop_phase n fireball Fluffy_Pillow 46909.0/50000: 94% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:24.550 rop_phase n fireball Fluffy_Pillow 47250.0/50000: 94% mana bloodlust, fireball(4), rune_of_power, potion_of_spectral_intellect
0:25.150 rop_phase h fire_blast Fluffy_Pillow 47850.0/50000: 96% mana bloodlust, fireball(4), rune_of_power
0:25.650 rop_phase i fire_blast Fluffy_Pillow 47850.0/50000: 96% mana bloodlust, fireball(5), heating_up, rune_of_power
0:25.890 rop_phase g pyroblast Fluffy_Pillow 46590.0/50000: 93% mana bloodlust, fireball(5), hot_streak, rune_of_power
0:26.784 standard_rotation w fireball Fluffy_Pillow 46484.0/50000: 93% mana bloodlust, hot_streak
0:28.127 standard_rotation p pyroblast Fluffy_Pillow 46827.0/50000: 94% mana bloodlust, hot_streak
0:29.021 standard_rotation w fireball Fluffy_Pillow 46721.0/50000: 93% mana bloodlust, fireball
0:30.362 standard_rotation w fireball Fluffy_Pillow 47062.0/50000: 94% mana bloodlust, fireball
0:31.704 standard_rotation w fireball Fluffy_Pillow 47404.0/50000: 95% mana bloodlust, heating_up
0:33.044 standard_rotation w fireball Fluffy_Pillow 47744.0/50000: 95% mana bloodlust, fireball
0:34.383 standard_rotation w fireball Fluffy_Pillow 48083.0/50000: 96% mana bloodlust, fireball(2)
0:35.483 standard_rotation r fire_blast Fluffy_Pillow 49183.0/50000: 98% mana bloodlust, heating_up
0:35.725 standard_rotation p pyroblast Fluffy_Pillow 47925.0/50000: 96% mana bloodlust, hot_streak
0:36.619 standard_rotation w fireball Fluffy_Pillow 47819.0/50000: 96% mana bloodlust, fireball, heating_up
0:37.519 standard_rotation r fire_blast Fluffy_Pillow 48719.0/50000: 97% mana bloodlust, fireball, heating_up
0:37.960 standard_rotation p pyroblast Fluffy_Pillow 47660.0/50000: 95% mana bloodlust, fireball, hot_streak, firestorm
0:38.854 standard_rotation o pyroblast Fluffy_Pillow 47554.0/50000: 95% mana bloodlust, fireball(2), heating_up, firestorm
0:39.747 standard_rotation o pyroblast Fluffy_Pillow 47447.0/50000: 95% mana bloodlust, fireball(2), hot_streak, firestorm
0:40.640 standard_rotation o pyroblast Fluffy_Pillow 47340.0/50000: 95% mana bloodlust, fireball(2), heating_up, firestorm
0:41.536 standard_rotation o pyroblast Fluffy_Pillow 47236.0/50000: 94% mana fireball(2), hot_streak, firestorm
0:42.698 standard_rotation o pyroblast Fluffy_Pillow 47398.0/50000: 95% mana fireball(2), heating_up, firestorm
0:43.861 standard_rotation o pyroblast Fluffy_Pillow 47561.0/50000: 95% mana fireball(2), hot_streak, firestorm
0:45.023 standard_rotation o pyroblast Fluffy_Pillow 47723.0/50000: 95% mana fireball(2), heating_up, firestorm
0:46.185 standard_rotation w fireball Fluffy_Pillow 47885.0/50000: 96% mana fireball(2), hot_streak, firestorm
0:47.925 standard_rotation o pyroblast Fluffy_Pillow 48625.0/50000: 97% mana fireball(2), hot_streak, firestorm
0:49.087 standard_rotation o pyroblast Fluffy_Pillow 48787.0/50000: 98% mana hot_streak, firestorm
0:50.251 standard_rotation w fireball Fluffy_Pillow 48951.0/50000: 98% mana heating_up
0:51.551 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:51.993 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, firestorm
0:53.154 standard_rotation o pyroblast Fluffy_Pillow 49103.0/50000: 98% mana fireball, heating_up, firestorm
0:54.317 standard_rotation o pyroblast Fluffy_Pillow 49266.0/50000: 99% mana fireball, hot_streak, firestorm
0:55.480 standard_rotation o pyroblast Fluffy_Pillow 49429.0/50000: 99% mana fireball, heating_up, firestorm
0:56.643 combustion_phase c fireball Fluffy_Pillow 49592.0/50000: 99% mana fireball, hot_streak
0:57.943 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
0:58.384 combustion_phase Z pyroblast Fluffy_Pillow 44441.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power
0:59.547 combustion_phase Z pyroblast Fluffy_Pillow 44604.0/50000: 89% mana combustion, hot_streak, rune_of_power
0:59.547 combustion_phase U fire_blast Fluffy_Pillow 43604.0/50000: 87% mana combustion, rune_of_power
1:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43504.0/50000: 87% mana combustion, heating_up, rune_of_power
1:00.710 combustion_phase Z pyroblast Fluffy_Pillow 44267.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:00.710 combustion_phase U fire_blast Fluffy_Pillow 43267.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:01.871 combustion_phase Z pyroblast Fluffy_Pillow 43928.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:03.036 combustion_phase b phoenix_flames Fluffy_Pillow 44093.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
1:04.198 combustion_phase Z pyroblast Fluffy_Pillow 45255.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:05.360 combustion_phase b phoenix_flames Fluffy_Pillow 45417.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
1:06.522 combustion_phase Z pyroblast Fluffy_Pillow 46579.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:06.622 combustion_phase U fire_blast Fluffy_Pillow 45679.0/50000: 91% mana combustion, rune_of_power, gladiators_badge
1:07.685 combustion_phase Z pyroblast Fluffy_Pillow 46242.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:08.848 combustion_phase e dragons_breath Fluffy_Pillow 46405.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:10.010 default O rune_of_power Fluffy_Pillow 45567.0/50000: 91% mana heating_up, gladiators_badge
1:11.173 rop_phase n fireball Fluffy_Pillow 46730.0/50000: 93% mana heating_up, rune_of_power, gladiators_badge
1:12.915 rop_phase n fireball Fluffy_Pillow 47472.0/50000: 95% mana heating_up, rune_of_power, gladiators_badge
1:14.656 rop_phase n fireball Fluffy_Pillow 48213.0/50000: 96% mana fireball, rune_of_power, gladiators_badge
1:16.056 rop_phase i fire_blast Fluffy_Pillow 49613.0/50000: 99% mana heating_up, rune_of_power
1:16.398 rop_phase g pyroblast Fluffy_Pillow 48455.0/50000: 97% mana hot_streak, rune_of_power, firestorm
1:17.561 rop_phase f pyroblast Fluffy_Pillow 48618.0/50000: 97% mana hot_streak, rune_of_power, firestorm
1:18.722 rop_phase f pyroblast Fluffy_Pillow 48779.0/50000: 98% mana heating_up, rune_of_power, firestorm
1:19.885 rop_phase f pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, rune_of_power, firestorm
1:21.048 rop_phase f pyroblast Fluffy_Pillow 49105.0/50000: 98% mana heating_up, rune_of_power, firestorm
1:22.211 rop_phase g pyroblast Fluffy_Pillow 49268.0/50000: 99% mana hot_streak, rune_of_power
1:23.375 standard_rotation t phoenix_flames Fluffy_Pillow 49432.0/50000: 99% mana
1:24.539 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana
1:26.281 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana
1:27.581 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:28.022 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:29.185 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
1:30.926 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:32.668 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:34.068 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:34.408 standard_rotation p pyroblast Fluffy_Pillow 48840.0/50000: 98% mana hot_streak
1:35.571 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
1:37.311 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
1:39.051 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
1:40.351 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:40.795 standard_rotation p pyroblast Fluffy_Pillow 48944.0/50000: 98% mana hot_streak
1:41.959 standard_rotation w fireball Fluffy_Pillow 49108.0/50000: 98% mana fireball
1:43.701 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:45.443 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:47.185 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
1:48.485 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:48.928 standard_rotation p pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak
1:50.093 standard_rotation w fireball Fluffy_Pillow 49108.0/50000: 98% mana hot_streak
1:51.835 standard_rotation p pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
1:52.998 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball
1:54.739 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:56.482 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up
1:58.225 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
1:59.387 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball
2:01.129 default M mirror_image Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:02.290 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana heating_up
2:04.031 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:05.772 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:07.513 combustion_phase c fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:08.813 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(3)
2:08.813 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(3), rune_of_power
2:09.256 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43943.0/50000: 88% mana combustion, fireball(3), heating_up, rune_of_power
2:09.256 combustion_phase b phoenix_flames Fluffy_Pillow 43943.0/50000: 88% mana combustion, fireball(3), heating_up, rune_of_power, gladiators_badge
2:10.419 combustion_phase Z pyroblast Fluffy_Pillow 45106.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:10.419 combustion_phase U fire_blast Fluffy_Pillow 44106.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:11.581 combustion_phase Z pyroblast Fluffy_Pillow 44768.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:11.581 combustion_phase U fire_blast Fluffy_Pillow 43768.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:12.744 combustion_phase Z pyroblast Fluffy_Pillow 44431.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:13.908 combustion_phase b phoenix_flames Fluffy_Pillow 44595.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
2:15.072 combustion_phase Z pyroblast Fluffy_Pillow 45759.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:16.237 combustion_phase Y pyroblast Fluffy_Pillow 45924.0/50000: 92% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
2:17.398 combustion_phase Y pyroblast Fluffy_Pillow 46085.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:18.560 combustion_phase U fire_blast Fluffy_Pillow 46247.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:18.560 combustion_phase Z pyroblast Fluffy_Pillow 45747.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:19.723 combustion_phase e dragons_breath Fluffy_Pillow 45910.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:20.885 default O rune_of_power Fluffy_Pillow 45072.0/50000: 90% mana heating_up, gladiators_badge
2:22.047 rop_phase n fireball Fluffy_Pillow 46234.0/50000: 92% mana heating_up, rune_of_power, gladiators_badge
2:23.787 rop_phase n fireball Fluffy_Pillow 46974.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
2:25.527 rop_phase n fireball Fluffy_Pillow 47714.0/50000: 95% mana fireball, rune_of_power
2:26.827 rop_phase i fire_blast Fluffy_Pillow 49014.0/50000: 98% mana heating_up, rune_of_power
2:27.267 rop_phase g pyroblast Fluffy_Pillow 47954.0/50000: 96% mana hot_streak, rune_of_power
2:28.430 rop_phase n fireball Fluffy_Pillow 48117.0/50000: 96% mana fireball, heating_up, rune_of_power
2:30.173 default N use_item_dreadfire_vessel Fluffy_Pillow 48860.0/50000: 98% mana fireball, heating_up, rune_of_power
2:30.173 rop_phase n fireball Fluffy_Pillow 48860.0/50000: 98% mana fireball, heating_up, rune_of_power
2:31.914 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power
2:33.214 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
2:33.656 rop_phase g pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, rune_of_power
2:34.817 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
2:36.558 standard_rotation t phoenix_flames Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:37.720 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:39.461 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:41.204 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
2:42.946 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:44.246 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:44.686 standard_rotation p pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak, firestorm
2:45.847 standard_rotation o pyroblast Fluffy_Pillow 49101.0/50000: 98% mana fireball, heating_up, firestorm
2:47.010 standard_rotation o pyroblast Fluffy_Pillow 49264.0/50000: 99% mana fireball, hot_streak, firestorm
2:48.172 standard_rotation o pyroblast Fluffy_Pillow 49426.0/50000: 99% mana fireball, heating_up, firestorm
2:49.335 standard_rotation w fireball Fluffy_Pillow 49589.0/50000: 99% mana fireball, hot_streak
2:51.076 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
2:52.240 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball(2)
2:53.982 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:55.282 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:55.722 standard_rotation p pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak
2:56.883 standard_rotation w fireball Fluffy_Pillow 49101.0/50000: 98% mana hot_streak
2:58.624 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
2:59.787 standard_rotation w fireball Fluffy_Pillow 49167.0/50000: 98% mana fireball
3:01.528 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
3:03.269 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:05.010 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
3:06.310 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:06.751 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
3:07.912 standard_rotation w fireball Fluffy_Pillow 49102.0/50000: 98% mana hot_streak
3:09.654 standard_rotation p pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
3:10.817 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball
3:12.557 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
3:14.298 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:16.039 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
3:17.780 combustion_phase c fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:19.080 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
3:19.080 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, hot_streak, rune_of_power
3:19.522 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power
3:19.522 combustion_phase Z pyroblast Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:20.685 combustion_phase Z pyroblast Fluffy_Pillow 44105.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:20.685 combustion_phase U fire_blast Fluffy_Pillow 43105.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
3:21.846 combustion_phase Z pyroblast Fluffy_Pillow 43766.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:21.846 combustion_phase U fire_blast Fluffy_Pillow 42766.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
3:23.009 combustion_phase Z pyroblast Fluffy_Pillow 43429.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:24.170 combustion_phase b phoenix_flames Fluffy_Pillow 43590.0/50000: 87% mana combustion, heating_up, rune_of_power, gladiators_badge
3:25.333 combustion_phase Z pyroblast Fluffy_Pillow 44753.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:26.495 combustion_phase b phoenix_flames Fluffy_Pillow 44915.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:27.657 combustion_phase Z pyroblast Fluffy_Pillow 46077.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:27.657 combustion_phase U fire_blast Fluffy_Pillow 45077.0/50000: 90% mana combustion, rune_of_power, gladiators_badge
3:28.819 combustion_phase Z pyroblast Fluffy_Pillow 45739.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:29.980 combustion_phase e dragons_breath Fluffy_Pillow 45900.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:31.144 default O rune_of_power Fluffy_Pillow 45064.0/50000: 90% mana heating_up, gladiators_badge
3:32.308 rop_phase n fireball Fluffy_Pillow 46228.0/50000: 92% mana heating_up, rune_of_power, gladiators_badge
3:34.050 rop_phase n fireball Fluffy_Pillow 46970.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
3:35.790 rop_phase n fireball Fluffy_Pillow 47710.0/50000: 95% mana fireball, rune_of_power
3:37.533 rop_phase n fireball Fluffy_Pillow 48453.0/50000: 97% mana fireball(2), rune_of_power
3:39.275 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), rune_of_power
3:40.575 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
3:41.019 rop_phase g pyroblast Fluffy_Pillow 48944.0/50000: 98% mana hot_streak, rune_of_power
3:42.182 rop_phase n fireball Fluffy_Pillow 49107.0/50000: 98% mana fireball, rune_of_power
3:43.923 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
3:44.023 rop_phase h fire_blast Fluffy_Pillow 49104.0/50000: 98% mana fireball, rune_of_power
3:45.664 standard_rotation v scorch Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:46.827 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana heating_up
3:47.988 standard_rotation q pyroblast Fluffy_Pillow 49503.0/50000: 99% mana hot_streak
3:49.150 standard_rotation v scorch Fluffy_Pillow 49665.0/50000: 99% mana
3:49.965 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
3:50.312 standard_rotation s pyroblast Fluffy_Pillow 49347.0/50000: 99% mana heating_up
3:51.485 standard_rotation v scorch Fluffy_Pillow 49520.0/50000: 99% mana
3:52.649 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
3:53.810 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
3:54.983 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana
3:56.146 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
3:57.308 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
3:58.480 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana
3:58.480 standard_rotation r fire_blast Fluffy_Pillow 49676.0/50000: 99% mana
3:59.643 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:00.815 default N use_item_dreadfire_vessel Fluffy_Pillow 49677.0/50000: 99% mana
4:00.815 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:01.978 default M mirror_image Fluffy_Pillow 49505.0/50000: 99% mana
4:03.141 standard_rotation v scorch Fluffy_Pillow 49668.0/50000: 99% mana heating_up
4:04.303 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:05.477 standard_rotation t phoenix_flames Fluffy_Pillow 49678.0/50000: 99% mana
4:06.639 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana
4:06.639 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
4:07.801 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:08.976 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:10.138 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:11.299 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:12.473 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:13.128 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
4:13.634 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:14.808 standard_rotation o pyroblast Fluffy_Pillow 49677.0/50000: 99% mana heating_up, firestorm
4:15.971 standard_rotation o pyroblast Fluffy_Pillow 49840.0/50000: 100% mana hot_streak, firestorm
4:17.134 default O rune_of_power Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
4:18.464 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
4:19.625 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
4:20.801 rop_phase h fire_blast Fluffy_Pillow 49679.0/50000: 99% mana rune_of_power
4:20.849 rop_phase m scorch Fluffy_Pillow 49227.0/50000: 98% mana heating_up, rune_of_power
4:22.010 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
4:23.185 rop_phase m scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, rune_of_power
4:24.347 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:25.521 rop_phase m scorch Fluffy_Pillow 49678.0/50000: 99% mana rune_of_power
4:26.682 rop_phase m scorch Fluffy_Pillow 49503.0/50000: 99% mana rune_of_power
4:27.846 rop_phase k pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
4:28.570 rop_phase h fire_blast Fluffy_Pillow 49215.0/50000: 98% mana rune_of_power
4:29.019 rop_phase m scorch Fluffy_Pillow 49179.0/50000: 98% mana heating_up, rune_of_power
4:30.182 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
4:31.355 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up
4:32.517 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:33.690 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up
4:34.853 combustion_phase a pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:36.025 combustion_phase c fireball Fluffy_Pillow 49677.0/50000: 99% mana
4:37.325 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana
4:37.325 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, rune_of_power
4:37.765 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, heating_up, rune_of_power
4:37.765 combustion_phase b phoenix_flames Fluffy_Pillow 43940.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
4:38.927 combustion_phase Z pyroblast Fluffy_Pillow 45102.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:40.090 combustion_phase b phoenix_flames Fluffy_Pillow 45265.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
4:41.483 combustion_phase Z pyroblast Fluffy_Pillow 46658.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:42.647 combustion_phase d scorch Fluffy_Pillow 46822.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
4:43.806 combustion_phase a pyroblast Fluffy_Pillow 47481.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
4:44.020 combustion_phase U fire_blast Fluffy_Pillow 46695.0/50000: 93% mana combustion, rune_of_power, gladiators_badge
4:44.981 combustion_phase Z pyroblast Fluffy_Pillow 47156.0/50000: 94% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:46.144 combustion_phase d scorch Fluffy_Pillow 47319.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
4:47.306 combustion_phase a pyroblast Fluffy_Pillow 47981.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
4:48.478 combustion_phase e dragons_breath Fluffy_Pillow 48153.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
4:49.640 standard_rotation v scorch Fluffy_Pillow 47315.0/50000: 95% mana heating_up, gladiators_badge
4:50.804 standard_rotation s pyroblast Fluffy_Pillow 47979.0/50000: 96% mana heating_up, gladiators_badge
4:51.976 standard_rotation v scorch Fluffy_Pillow 48151.0/50000: 96% mana heating_up, gladiators_badge
4:51.976 standard_rotation r fire_blast Fluffy_Pillow 48151.0/50000: 96% mana heating_up, gladiators_badge
4:53.138 standard_rotation q pyroblast Fluffy_Pillow 48313.0/50000: 97% mana hot_streak
4:54.301 standard_rotation v scorch Fluffy_Pillow 48476.0/50000: 97% mana
4:55.464 standard_rotation v scorch Fluffy_Pillow 49139.0/50000: 98% mana
4:56.625 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:57.799 standard_rotation o pyroblast Fluffy_Pillow 49677.0/50000: 99% mana heating_up, firestorm
4:58.961 standard_rotation o pyroblast Fluffy_Pillow 49839.0/50000: 100% mana hot_streak, firestorm
4:59.761 standard_rotation r fire_blast Fluffy_Pillow 49639.0/50000: 99% mana heating_up, firestorm
5:00.124 standard_rotation o pyroblast Fluffy_Pillow 49502.0/50000: 99% mana hot_streak, firestorm
5:01.285 standard_rotation o pyroblast Fluffy_Pillow 49663.0/50000: 99% mana heating_up, firestorm
5:02.447 standard_rotation o pyroblast Fluffy_Pillow 49825.0/50000: 100% mana hot_streak, firestorm
5:03.610 default O rune_of_power Fluffy_Pillow 49988.0/50000: 100% mana heating_up, firestorm
5:04.773 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
5:05.937 rop_phase k pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
5:07.109 rop_phase h fire_blast Fluffy_Pillow 49678.0/50000: 99% mana rune_of_power
5:07.175 rop_phase l phoenix_flames Fluffy_Pillow 49244.0/50000: 98% mana heating_up, rune_of_power
5:08.337 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power
5:09.499 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
5:10.661 rop_phase m scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
5:11.824 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
5:12.997 rop_phase m scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, rune_of_power, firestorm
5:14.161 rop_phase f pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power, firestorm
5:15.323 rop_phase f pyroblast Fluffy_Pillow 49668.0/50000: 99% mana hot_streak, rune_of_power, firestorm
5:15.323 rop_phase h fire_blast Fluffy_Pillow 48668.0/50000: 97% mana rune_of_power, firestorm
5:16.486 rop_phase g pyroblast Fluffy_Pillow 49331.0/50000: 99% mana hot_streak, rune_of_power
5:17.650 standard_rotation v scorch Fluffy_Pillow 49495.0/50000: 99% mana
5:18.811 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana

Stats

Level Bonus (60) Race Bonus (dwarf) Raid-Buffed Unbuffed Gear Amount
Strength 198 2 200 200 0
Agility 306 -2 304 304 0
Stamina 414 1 2019 1923 1508
Intellect 450 -1 1815 1634 1108 (132)
Spirit 0 0 0 0 0
Health 40380 38460 0
Mana 50000 50000 0
Spell Power 1815 1634 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="dwarf"
source=default
spec=fire
level=60
race=dwarf
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

fire : 5142 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5141.6 5141.6 9.7 / 0.188% 800.1 / 15.6% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
810.2 805.1 Mana 0.00% 58.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
fire 5142
Conflagration Flare Up 24 0.5% 30.0 9.57sec 237 0 Direct 30.0 149 374 237 38.7%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.02 30.02 0.00 0.00 0.0000 0.0000 7102.02 7102.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.29% 18.40 6 39 149.50 130 254 149.54 132 172 2751 2751 0.00%
crit 38.71% 11.62 3 25 374.36 259 509 374.75 282 465 4351 4351 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 22 0.4% 1.6 112.74sec 4051 3963 Direct 1.6 0 4051 4051 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.60 1.60 0.00 0.00 1.0223 0.0000 6495.74 6495.74 0.00% 3963.24 3963.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 1.60 0 5 4050.63 3781 4392 3726.65 0 4392 6496 6496 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [f]:1.61
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 160 3.1% 3.3 103.60sec 14569 0 Direct 3.3 11650 23320 14626 25.5%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.29 3.28 0.00 0.00 0.0000 0.0000 47925.28 47925.28 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.47% 2.44 0 4 11649.91 11342 12023 11501.34 0 12023 28422 28422 0.00%
crit 25.53% 0.84 0 4 23319.58 22685 24046 14242.52 0 24046 19503 19503 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 605 11.8% 42.6 7.10sec 4261 0 Direct 42.6 0 4261 4261 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.62 42.62 0.00 0.00 0.0000 0.0000 181612.80 181612.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.62 33 51 4261.38 3040 5972 4262.76 4034 4527 181613 181613 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [V]:17.05
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [i]:2.95
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [j]:5.40
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [s]:17.23
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 612 (641) 11.9% (12.5%) 77.5 3.38sec 2485 1498 Direct 77.4 (222.6) 1655 3446 2374 40.1% (40.1%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.45 77.44 0.00 0.00 1.6591 0.0000 183843.65 183843.65 0.00% 1497.74 1497.74
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.85% 46.35 25 64 1654.82 1435 2572 1655.51 1533 1784 76705 76705 0.00%
crit 40.15% 31.09 18 46 3445.89 2869 5636 3449.02 3261 3735 107139 107139 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [d]:4.72
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [o]:21.22
    standard_rotation
    [x]:51.56
    Conflagration 29 0.6% 77.4 3.37sec 111 0 Periodic 145.1 36 90 59 43.5% 69.2%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.44 0.00 145.15 145.15 0.0000 1.4331 8613.81 8613.81 0.00% 41.41 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 56.55% 82.08 54 110 35.59 0 57 35.58 33 38 2921 2921 0.00%
crit 43.45% 63.07 43 87 90.27 0 124 90.40 84 99 5693 5693 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 974 18.9% 266.7 1.13sec 1095 0 Periodic 299.2 976 0 976 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 266.71 0.00 299.20 299.20 0.0000 1.0000 292122.02 292122.02 0.00% 976.34 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 976.18 151 3253 977.75 836 1144 292122 292122 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.47sec 3718 4807

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7737 0.0000 0.00 0.00 0.00% 4807.27 4807.27

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 99  / 37 0.7% 238.8 3.41sec 47 34 Direct 238.1 38 75 47 24.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 238.84 238.11 0.00 0.00 1.3825 0.0000 11119.22 11119.22 0.00% 33.68 33.68
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.66% 180.14 115 213 37.53 28 53 37.61 35 41 6762 6762 0.00%
crit 24.34% 57.97 28 86 75.15 57 106 75.31 66 86 4357 4357 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:82.65
Phoenix Flames 0 (243) 0.0% (4.7%) 14.1 21.64sec 5151 4805

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.13 0.00 0.00 0.00 1.0722 0.0000 0.00 0.00 0.00% 4804.94 4804.94

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [c]:10.22
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [m]:1.35
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [u]:2.55
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 243 4.7% 14.1 21.65sec 5162 0 Direct 14.1 2113 5965 5164 79.2%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 0.00 0.00 0.0000 0.0000 72770.77 72770.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 20.82% 2.94 0 9 2112.84 1727 3393 2075.32 0 3393 6201 6201 0.00%
crit 79.18% 11.16 6 16 5964.90 3454 6786 5971.41 5167 6427 66569 66569 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2092 (2224) 40.7% (43.3%) 98.1 3.07sec 6802 6178 Direct 98.8 (277.9) 3047 7779 6354 69.9% (69.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.08 98.77 0.00 0.00 1.1011 0.0000 627499.32 627499.32 0.00% 6177.69 6177.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 30.12% 29.75 18 44 3047.00 2616 5139 3046.15 2780 3325 90666 90666 0.00%
crit 69.88% 69.02 39 108 7779.19 5232 10277 7802.44 7095 8697 536833 536833 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Z]:7.76
  • if_expr:buff.firestorm.react
    combustion_phase
    [a]:26.66
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [b]:3.48
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [g]:4.90
  • if_expr:buff.firestorm.react
    rop_phase
    [h]:8.80
  • if_expr:buff.hot_streak.react
    rop_phase
    [l]:3.41
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [p]:12.59
  • if_expr:buff.firestorm.react
    standard_rotation
    [q]:15.39
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [r]:4.18
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [t]:10.87
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.6% 98.8 3.07sec 402 0 Periodic 179.1 136 350 222 40.1% 86.3%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.77 0.00 179.08 179.08 0.0000 1.4476 39684.71 39684.71 0.00% 153.08 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.85% 107.19 71 149 135.63 5 234 135.63 127 144 14538 14538 0.00%
crit 40.15% 71.90 49 102 349.77 10 467 350.29 325 386 25147 25147 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 212 4.1% 33.8 7.59sec 1887 1646 Direct 33.8 0 1888 1888 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.82 33.81 0.00 0.00 1.1467 0.0000 63822.45 63822.45 0.00% 1645.88 1645.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.81 17 50 1887.87 1008 3337 1889.98 1698 2174 63822 63822 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [e]:3.94
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [n]:8.03
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [w]:22.23
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
fire
Berserking 2.0 0.00sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    combustion_cooldowns
    [T]:2.00
Combustion 4.7 70.62sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [X]:4.70
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fire
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fire
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.17
Rune of Power 5.3 60.25sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 0.00 0.00 0.00 1.0958 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.32
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 210.0sec 0.0sec 12.0sec 8.10% 30.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:fire
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:187.6s / 232.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.10%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:fire
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.3sec 70.3sec 11.8sec 18.50% 0.00% 106.3 (106.3) 4.5

Buff Details

  • buff initial source:fire
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:49.9s / 89.2s
  • trigger_min/max:49.9s / 89.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.50%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.5 24.8 9.2sec 4.2sec 5.1sec 36.82% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:fire
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 46.6s
  • trigger_min/max:1.3s / 43.7s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 29.5s

Stack Uptimes

  • fireball_1:20.61%
  • fireball_2:8.92%
  • fireball_3:4.47%
  • fireball_4:1.97%
  • fireball_5:0.66%
  • fireball_6:0.17%
  • fireball_7:0.02%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.9 0.9 36.2sec 32.2sec 4.2sec 11.11% 0.00% 0.9 (0.9) 7.8

Buff Details

  • buff initial source:fire
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 161.6s
  • trigger_min/max:0.8s / 161.6s
  • trigger_pct:10.19%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • firestorm_1:11.11%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 70.7sec 72.5sec 14.7sec 23.02% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:fire
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 89.2s
  • trigger_min/max:60.0s / 89.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:23.02%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 97.5 0.0 3.1sec 3.1sec 1.1sec 35.96% 46.71% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:fire
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 17.9s
  • trigger_min/max:0.1s / 17.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.2s

Stack Uptimes

  • heating_up_1:35.96%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 85.5 0.0 3.5sec 3.5sec 0.6sec 12.64% 86.32% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:fire
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 32.1s
  • trigger_min/max:0.6s / 32.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.5s

Stack Uptimes

  • hot_streak_1:12.64%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 314.8sec 0.0sec 23.5sec 9.18% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:fire
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.18%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.1sec 11.9sec 39.00% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:fire
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 73.5s
  • trigger_min/max:6.0s / 73.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • rune_of_power_1:39.00%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:fire
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:fire
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 97.5 74.0 123.0 3.1s 0.1s 17.9s
Heating Up removed 11.6 4.0 23.0 23.7s 1.1s 216.6s
Heating Up converted with Fire Blast 23.2 13.0 35.0 12.1s 0.6s 95.1s
Hot Streak procs 85.5 64.0 114.0 3.5s 0.6s 32.1s
Hot Streak spells used 266.7 214.0 323.0 1.1s 0.0s 5.4s
Hot Streak spell crits 187.7 145.0 239.0 1.6s 0.0s 17.4s
Hot Streak spell crits wasted 4.7 0.0 12.0 64.6s 0.1s 319.1s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 13.25% 8.89% 17.46% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3580.00012.8731.0740.00013.382
Rune of Power13.9320.00040.58876.17923.890129.328
Fire Blast0.0990.00022.9894.2091.10029.577
Dragon's Breath68.50713.043305.088272.004175.413359.850
Combustion2.1871.10011.68110.3275.13821.416
Phoenix Flames0.1710.00020.6572.4341.58027.566

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
fire
mana_regen Mana 2190.89 241903.01 100.00% 110.41 58253.60 19.41%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 805.08 810.22 58251.8 48454.2 42267.0 50000.0
Usage Type Count Total Avg RPE APR
fire
combustion Mana 4.7 23517.0 5000.0 5002.3 0.0
dragons_breath Mana 1.6 3214.1 2000.0 2004.6 2.0
fire_blast Mana 42.6 21309.9 500.0 500.0 8.5
fireball Mana 77.5 77478.9 1000.0 1000.4 2.5
mirror_image Mana 3.0 1990.8 665.6 665.7 5.6
pyroblast Mana 99.1 99052.5 1000.0 1009.9 6.7
scorch Mana 33.8 16899.9 500.0 499.8 3.8

Statistics & Data Analysis

Fight Length
fire Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
fire Damage Per Second
Count 1717
Mean 5141.65
Minimum 4516.74
Maximum 5870.08
Spread ( max - min ) 1353.34
Range [ ( max - min ) / 2 * 100% ] 13.16%
Standard Deviation 204.1888
5th Percentile 4831.22
95th Percentile 5508.25
( 95th Percentile - 5th Percentile ) 677.02
Mean Distribution
Standard Deviation 4.9277
95.00% Confidence Interval ( 5131.99 - 5151.31 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6059
0.1 Scale Factor Error with Delta=300 356
0.05 Scale Factor Error with Delta=300 1424
0.01 Scale Factor Error with Delta=300 35592
Priority Target DPS
fire Priority Target Damage Per Second
Count 1717
Mean 5141.65
Minimum 4516.74
Maximum 5870.08
Spread ( max - min ) 1353.34
Range [ ( max - min ) / 2 * 100% ] 13.16%
Standard Deviation 204.1888
5th Percentile 4831.22
95th Percentile 5508.25
( 95th Percentile - 5th Percentile ) 677.02
Mean Distribution
Standard Deviation 4.9277
95.00% Confidence Interval ( 5131.99 - 5151.31 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6059
0.1 Scale Factor Error with Delta=300 356
0.05 Scale Factor Error with Delta=300 1424
0.01 Scale Factor Error with Delta=300 35592
DPS(e)
fire Damage Per Second (Effective)
Count 1717
Mean 5141.65
Minimum 4516.74
Maximum 5870.08
Spread ( max - min ) 1353.34
Range [ ( max - min ) / 2 * 100% ] 13.16%
Damage
fire Damage
Count 1717
Mean 1531492.58
Minimum 1183047.65
Maximum 2004298.01
Spread ( max - min ) 821250.35
Range [ ( max - min ) / 2 * 100% ] 26.81%
DTPS
fire Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
fire Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
fire Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
fire Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
fire Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
fire Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
fireTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
fire Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.29 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.32 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.17 potion
0.00 blood_fury
T 2.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
U 4.70 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
V 17.05 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
W 0.00 call_action_list,name=active_talents
X 4.70 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Y 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Z 7.76 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
a 26.66 pyroblast,if=buff.hot_streak.react&buff.combustion.up
b 3.48 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
c 10.22 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
d 4.72 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
e 3.94 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
f 1.61 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
g 4.90 pyroblast,if=buff.firestorm.react
h 8.80 pyroblast,if=buff.hot_streak.react
i 2.95 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
j 5.40 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
k 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
l 3.41 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
m 1.35 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
n 8.03 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
o 21.22 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
p 12.59 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
q 15.39 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
r 4.18 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
s 17.23 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
t 10.87 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
u 2.55 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
v 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
w 22.23 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
x 51.56 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTUdXVcaVaVacacaVaebebVaZOgghooNoohihojhxxxsqxxxxxqxxsqxxxxsqxxxxqdXUaaVaVaVacacafVOhoomooojhxxxsqpppxqxsqxxsqxxxsqxxxxMxxxxxxdXVUcaVaVacaebVafOooojhoNmooxsqpppxqxsqxxxxsqpppxqxqxsqpppdXTUaaVaVacacaVaebOojhoooojhoxxsqwwtwwtwsrwwtMwstwNwtwwsrwrwwOgigghnnlinlnntwdXVUaacacaVacafwtpspppwtwwsrwwtOnilnnlnlimnnlwwtws

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask fire 50000.0/50000: 100% mana
Pre precombat 1 food fire 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T berserking Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana berserking, potion_of_spectral_intellect
0:00.000 combustion_phase d fireball Fluffy_Pillow 49000.0/50000: 98% mana berserking, gladiators_badge, potion_of_spectral_intellect
0:01.100 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, berserking, gladiators_badge, potion_of_spectral_intellect
0:01.100 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, berserking, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.586 combustion_phase c phoenix_flames Fluffy_Pillow 43986.0/50000: 88% mana bloodlust, berserking, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.399 combustion_phase a pyroblast Fluffy_Pillow 44799.0/50000: 90% mana bloodlust, berserking, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.399 combustion_phase V fire_blast Fluffy_Pillow 43799.0/50000: 88% mana bloodlust, berserking, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.212 combustion_phase a pyroblast Fluffy_Pillow 44112.0/50000: 88% mana bloodlust, berserking, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.212 combustion_phase V fire_blast Fluffy_Pillow 43112.0/50000: 86% mana bloodlust, berserking, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.025 combustion_phase a pyroblast Fluffy_Pillow 43425.0/50000: 87% mana bloodlust, berserking, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.839 combustion_phase c phoenix_flames Fluffy_Pillow 43239.0/50000: 86% mana bloodlust, berserking, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.651 combustion_phase a pyroblast Fluffy_Pillow 44051.0/50000: 88% mana bloodlust, berserking, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.466 combustion_phase c phoenix_flames Fluffy_Pillow 43866.0/50000: 88% mana bloodlust, berserking, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.280 combustion_phase a pyroblast Fluffy_Pillow 44680.0/50000: 89% mana bloodlust, berserking, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.280 combustion_phase V fire_blast Fluffy_Pillow 43680.0/50000: 87% mana bloodlust, berserking, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.095 combustion_phase a pyroblast Fluffy_Pillow 43995.0/50000: 88% mana bloodlust, berserking, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.908 combustion_phase e scorch Fluffy_Pillow 43808.0/50000: 88% mana bloodlust, berserking, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.721 combustion_phase b pyroblast Fluffy_Pillow 44121.0/50000: 88% mana bloodlust, berserking, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.546 combustion_phase e scorch Fluffy_Pillow 43946.0/50000: 88% mana bloodlust, berserking, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.360 combustion_phase b pyroblast Fluffy_Pillow 44260.0/50000: 89% mana bloodlust, berserking, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.970 combustion_phase V fire_blast Fluffy_Pillow 43870.0/50000: 88% mana bloodlust, berserking, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.185 combustion_phase a pyroblast Fluffy_Pillow 43585.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:13.080 combustion_phase Z pyroblast Fluffy_Pillow 43480.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:13.975 default O rune_of_power Fluffy_Pillow 43375.0/50000: 87% mana bloodlust, hot_streak, firestorm, gladiators_badge, potion_of_spectral_intellect
0:14.867 rop_phase g pyroblast Fluffy_Pillow 44267.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:15.762 rop_phase g pyroblast Fluffy_Pillow 44162.0/50000: 88% mana bloodlust, heating_up, rune_of_power, firestorm, potion_of_spectral_intellect
0:16.656 rop_phase h pyroblast Fluffy_Pillow 44056.0/50000: 88% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:17.550 rop_phase o fireball Fluffy_Pillow 43950.0/50000: 88% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:18.890 rop_phase o fireball Fluffy_Pillow 44290.0/50000: 89% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:20.230 default N use_item_dreadfire_vessel Fluffy_Pillow 44630.0/50000: 89% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:20.230 rop_phase o fireball Fluffy_Pillow 44630.0/50000: 89% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:21.572 rop_phase o fireball Fluffy_Pillow 44972.0/50000: 90% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:22.911 rop_phase h pyroblast Fluffy_Pillow 45311.0/50000: 91% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:23.804 rop_phase i fire_blast Fluffy_Pillow 45204.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:23.804 rop_phase h pyroblast Fluffy_Pillow 44704.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:24.698 rop_phase o fireball Fluffy_Pillow 44598.0/50000: 89% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:25.598 rop_phase j fire_blast Fluffy_Pillow 45498.0/50000: 91% mana bloodlust, heating_up, rune_of_power
0:26.036 rop_phase h pyroblast Fluffy_Pillow 44436.0/50000: 89% mana bloodlust, hot_streak, rune_of_power
0:26.930 standard_rotation x fireball Fluffy_Pillow 44330.0/50000: 89% mana bloodlust, fireball, heating_up
0:28.271 standard_rotation x fireball Fluffy_Pillow 44671.0/50000: 89% mana bloodlust, fireball, heating_up
0:29.613 standard_rotation x fireball Fluffy_Pillow 45013.0/50000: 90% mana bloodlust, fireball(2)
0:30.913 standard_rotation s fire_blast Fluffy_Pillow 46313.0/50000: 93% mana bloodlust, heating_up
0:30.953 standard_rotation q pyroblast Fluffy_Pillow 44853.0/50000: 90% mana bloodlust, hot_streak
0:31.846 standard_rotation x fireball Fluffy_Pillow 44746.0/50000: 89% mana bloodlust, fireball
0:33.187 standard_rotation x fireball Fluffy_Pillow 45087.0/50000: 90% mana bloodlust, fireball
0:34.527 standard_rotation x fireball Fluffy_Pillow 45427.0/50000: 91% mana bloodlust, fireball(2)
0:35.869 standard_rotation x fireball Fluffy_Pillow 45769.0/50000: 92% mana bloodlust, heating_up
0:37.209 standard_rotation x fireball Fluffy_Pillow 46109.0/50000: 92% mana bloodlust, hot_streak
0:38.551 standard_rotation q pyroblast Fluffy_Pillow 46451.0/50000: 93% mana bloodlust, fireball, hot_streak
0:39.446 standard_rotation x fireball Fluffy_Pillow 46346.0/50000: 93% mana bloodlust, fireball(2)
0:40.786 standard_rotation x fireball Fluffy_Pillow 46686.0/50000: 93% mana bloodlust, fireball(2)
0:41.886 standard_rotation s fire_blast Fluffy_Pillow 47786.0/50000: 96% mana heating_up
0:42.127 standard_rotation q pyroblast Fluffy_Pillow 46527.0/50000: 93% mana hot_streak
0:43.291 standard_rotation x fireball Fluffy_Pillow 46691.0/50000: 93% mana fireball
0:45.033 standard_rotation x fireball Fluffy_Pillow 47433.0/50000: 95% mana fireball
0:46.774 standard_rotation x fireball Fluffy_Pillow 48174.0/50000: 96% mana fireball(2)
0:48.515 standard_rotation x fireball Fluffy_Pillow 48915.0/50000: 98% mana fireball(3)
0:49.815 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:50.256 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
0:51.418 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana heating_up
0:53.160 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
0:54.903 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
0:56.644 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
0:58.384 standard_rotation q pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak
0:59.546 combustion_phase d fireball Fluffy_Pillow 49165.0/50000: 98% mana hot_streak
1:00.846 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
1:01.286 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44440.0/50000: 89% mana combustion, hot_streak, rune_of_power
1:01.286 combustion_phase a pyroblast Fluffy_Pillow 44440.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:02.451 combustion_phase a pyroblast Fluffy_Pillow 44605.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:02.451 combustion_phase V fire_blast Fluffy_Pillow 43605.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:03.613 combustion_phase a pyroblast Fluffy_Pillow 44267.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:03.613 combustion_phase V fire_blast Fluffy_Pillow 43267.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:04.775 combustion_phase a pyroblast Fluffy_Pillow 43929.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:04.975 combustion_phase V fire_blast Fluffy_Pillow 43129.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
1:05.936 combustion_phase a pyroblast Fluffy_Pillow 43590.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:07.098 combustion_phase c phoenix_flames Fluffy_Pillow 43752.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
1:08.260 combustion_phase a pyroblast Fluffy_Pillow 44914.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:09.422 combustion_phase c phoenix_flames Fluffy_Pillow 45076.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
1:10.585 combustion_phase a pyroblast Fluffy_Pillow 46239.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:11.749 combustion_phase f dragons_breath Fluffy_Pillow 46403.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:12.649 combustion_phase V fire_blast Fluffy_Pillow 45303.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
1:12.912 default O rune_of_power Fluffy_Pillow 45066.0/50000: 90% mana hot_streak, gladiators_badge
1:14.076 rop_phase h pyroblast Fluffy_Pillow 46230.0/50000: 92% mana hot_streak, rune_of_power, gladiators_badge
1:15.240 rop_phase o fireball Fluffy_Pillow 46394.0/50000: 93% mana rune_of_power, gladiators_badge
1:16.982 rop_phase o fireball Fluffy_Pillow 47136.0/50000: 94% mana rune_of_power
1:18.724 rop_phase m phoenix_flames Fluffy_Pillow 47878.0/50000: 96% mana heating_up, rune_of_power
1:19.886 rop_phase o fireball Fluffy_Pillow 49040.0/50000: 98% mana fireball, rune_of_power
1:21.628 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
1:23.367 rop_phase o fireball Fluffy_Pillow 49002.0/50000: 98% mana fireball(2), rune_of_power
1:24.667 rop_phase j fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
1:25.109 rop_phase h pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, rune_of_power
1:26.270 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
1:28.011 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:29.751 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
1:31.051 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:31.492 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, firestorm
1:32.654 standard_rotation p pyroblast Fluffy_Pillow 49103.0/50000: 98% mana fireball, heating_up, firestorm
1:33.817 standard_rotation p pyroblast Fluffy_Pillow 49266.0/50000: 99% mana fireball, hot_streak, firestorm
1:34.981 standard_rotation p pyroblast Fluffy_Pillow 49430.0/50000: 99% mana fireball, heating_up, firestorm
1:36.144 standard_rotation x fireball Fluffy_Pillow 49593.0/50000: 99% mana fireball, hot_streak
1:37.886 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana fireball, hot_streak
1:39.049 standard_rotation x fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball(2), heating_up
1:40.349 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), heating_up
1:40.790 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana fireball(2), hot_streak
1:41.952 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball(3)
1:43.694 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
1:45.194 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:45.434 standard_rotation q pyroblast Fluffy_Pillow 48740.0/50000: 97% mana hot_streak
1:46.596 standard_rotation x fireball Fluffy_Pillow 48902.0/50000: 98% mana heating_up
1:48.337 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
1:50.077 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
1:51.777 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:51.818 standard_rotation q pyroblast Fluffy_Pillow 48541.0/50000: 97% mana hot_streak
1:52.981 standard_rotation x fireball Fluffy_Pillow 48704.0/50000: 97% mana fireball, heating_up
1:54.723 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, heating_up
1:56.465 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:58.204 standard_rotation x fireball Fluffy_Pillow 49002.0/50000: 98% mana heating_up
1:59.945 default M mirror_image Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:01.161 standard_rotation x fireball Fluffy_Pillow 49220.0/50000: 98% mana fireball(2)
2:02.902 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:04.645 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(3)
2:06.388 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(4)
2:08.130 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:09.873 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
2:11.616 combustion_phase d fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
2:12.916 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:12.916 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power
2:13.357 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43941.0/50000: 88% mana combustion, hot_streak, rune_of_power
2:13.357 combustion_phase c phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:14.520 combustion_phase a pyroblast Fluffy_Pillow 45104.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:14.520 combustion_phase V fire_blast Fluffy_Pillow 44104.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:15.682 combustion_phase a pyroblast Fluffy_Pillow 44766.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:15.682 combustion_phase V fire_blast Fluffy_Pillow 43766.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:16.845 combustion_phase a pyroblast Fluffy_Pillow 44429.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:18.007 combustion_phase c phoenix_flames Fluffy_Pillow 44591.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
2:19.170 combustion_phase a pyroblast Fluffy_Pillow 45754.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:20.332 combustion_phase e scorch Fluffy_Pillow 45916.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:21.495 combustion_phase b pyroblast Fluffy_Pillow 46579.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:22.205 combustion_phase V fire_blast Fluffy_Pillow 46289.0/50000: 93% mana combustion, rune_of_power, gladiators_badge
2:22.668 combustion_phase a pyroblast Fluffy_Pillow 46252.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.832 combustion_phase f dragons_breath Fluffy_Pillow 46416.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:24.996 default O rune_of_power Fluffy_Pillow 45580.0/50000: 91% mana heating_up, gladiators_badge
2:26.158 rop_phase o fireball Fluffy_Pillow 46742.0/50000: 93% mana heating_up, rune_of_power, gladiators_badge
2:27.899 rop_phase o fireball Fluffy_Pillow 47483.0/50000: 95% mana heating_up, rune_of_power, gladiators_badge
2:29.640 rop_phase o fireball Fluffy_Pillow 48224.0/50000: 96% mana fireball, rune_of_power
2:30.940 rop_phase j fire_blast Fluffy_Pillow 49524.0/50000: 99% mana heating_up, rune_of_power
2:31.381 rop_phase h pyroblast Fluffy_Pillow 48465.0/50000: 97% mana hot_streak, rune_of_power
2:32.544 rop_phase o fireball Fluffy_Pillow 48628.0/50000: 97% mana heating_up, rune_of_power
2:34.287 default N use_item_dreadfire_vessel Fluffy_Pillow 49006.0/50000: 98% mana heating_up, rune_of_power
2:34.287 rop_phase m phoenix_flames Fluffy_Pillow 49006.0/50000: 98% mana heating_up, rune_of_power
2:35.449 rop_phase o fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball, rune_of_power
2:37.191 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
2:38.933 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:40.533 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:40.675 standard_rotation q pyroblast Fluffy_Pillow 48642.0/50000: 97% mana hot_streak, firestorm
2:41.837 standard_rotation p pyroblast Fluffy_Pillow 48804.0/50000: 98% mana fireball, heating_up, firestorm
2:43.001 standard_rotation p pyroblast Fluffy_Pillow 48968.0/50000: 98% mana fireball, hot_streak, firestorm
2:44.165 standard_rotation p pyroblast Fluffy_Pillow 49132.0/50000: 98% mana fireball, heating_up, firestorm
2:45.329 standard_rotation x fireball Fluffy_Pillow 49296.0/50000: 99% mana fireball, hot_streak
2:47.069 standard_rotation q pyroblast Fluffy_Pillow 49003.0/50000: 98% mana fireball, hot_streak
2:48.232 standard_rotation x fireball Fluffy_Pillow 49166.0/50000: 98% mana heating_up
2:49.532 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:49.973 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
2:51.135 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana heating_up
2:52.876 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:54.616 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
2:56.359 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
2:57.759 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:58.101 standard_rotation q pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak, firestorm
2:59.264 standard_rotation p pyroblast Fluffy_Pillow 49005.0/50000: 98% mana fireball, heating_up, firestorm
3:00.425 standard_rotation p pyroblast Fluffy_Pillow 49166.0/50000: 98% mana fireball, hot_streak, firestorm
3:01.588 standard_rotation p pyroblast Fluffy_Pillow 49329.0/50000: 99% mana fireball, heating_up, firestorm
3:02.750 standard_rotation x fireball Fluffy_Pillow 49491.0/50000: 99% mana fireball, hot_streak
3:04.491 standard_rotation q pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
3:05.653 standard_rotation x fireball Fluffy_Pillow 49166.0/50000: 98% mana hot_streak
3:07.393 standard_rotation q pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak
3:08.555 standard_rotation x fireball Fluffy_Pillow 49165.0/50000: 98% mana fireball, heating_up
3:09.855 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
3:10.296 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana fireball, hot_streak, firestorm
3:11.459 standard_rotation p pyroblast Fluffy_Pillow 49104.0/50000: 98% mana fireball(2), heating_up, firestorm
3:12.623 standard_rotation p pyroblast Fluffy_Pillow 49268.0/50000: 99% mana fireball(2), hot_streak, firestorm
3:13.785 standard_rotation p pyroblast Fluffy_Pillow 49430.0/50000: 99% mana fireball(2), heating_up, firestorm
3:14.949 combustion_phase d fireball Fluffy_Pillow 49594.0/50000: 99% mana fireball(2), hot_streak
3:16.249 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), hot_streak
3:16.692 combustion_cooldowns T berserking Fluffy_Pillow 44443.0/50000: 89% mana combustion, fireball(2), hot_streak, rune_of_power
3:16.692 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44443.0/50000: 89% mana berserking, combustion, fireball(2), hot_streak, rune_of_power
3:16.692 combustion_phase a pyroblast Fluffy_Pillow 44443.0/50000: 89% mana berserking, combustion, fireball(2), hot_streak, rune_of_power, gladiators_badge
3:17.750 combustion_phase a pyroblast Fluffy_Pillow 44501.0/50000: 89% mana berserking, combustion, hot_streak, rune_of_power, gladiators_badge
3:17.750 combustion_phase V fire_blast Fluffy_Pillow 43501.0/50000: 87% mana berserking, combustion, rune_of_power, gladiators_badge
3:18.809 combustion_phase a pyroblast Fluffy_Pillow 44060.0/50000: 88% mana berserking, combustion, hot_streak, rune_of_power, gladiators_badge
3:18.809 combustion_phase V fire_blast Fluffy_Pillow 43060.0/50000: 86% mana berserking, combustion, rune_of_power, gladiators_badge
3:19.866 combustion_phase a pyroblast Fluffy_Pillow 43617.0/50000: 87% mana berserking, combustion, hot_streak, rune_of_power, gladiators_badge
3:20.922 combustion_phase c phoenix_flames Fluffy_Pillow 43673.0/50000: 87% mana berserking, combustion, heating_up, rune_of_power, gladiators_badge
3:21.978 combustion_phase a pyroblast Fluffy_Pillow 44729.0/50000: 89% mana berserking, combustion, hot_streak, rune_of_power, gladiators_badge
3:23.035 combustion_phase c phoenix_flames Fluffy_Pillow 44786.0/50000: 90% mana berserking, combustion, heating_up, rune_of_power, gladiators_badge
3:24.093 combustion_phase a pyroblast Fluffy_Pillow 45844.0/50000: 92% mana berserking, combustion, hot_streak, rune_of_power, gladiators_badge
3:24.093 combustion_phase V fire_blast Fluffy_Pillow 44844.0/50000: 90% mana berserking, combustion, rune_of_power, gladiators_badge
3:25.151 combustion_phase a pyroblast Fluffy_Pillow 45402.0/50000: 91% mana berserking, combustion, hot_streak, rune_of_power, gladiators_badge
3:26.207 combustion_phase e scorch Fluffy_Pillow 45458.0/50000: 91% mana berserking, combustion, heating_up, rune_of_power, gladiators_badge
3:27.262 combustion_phase b pyroblast Fluffy_Pillow 46013.0/50000: 92% mana berserking, combustion, heating_up, rune_of_power, gladiators_badge
3:28.330 default O rune_of_power Fluffy_Pillow 46081.0/50000: 92% mana berserking, heating_up, gladiators_badge
3:29.388 rop_phase o fireball Fluffy_Pillow 47139.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
3:30.688 rop_phase j fire_blast Fluffy_Pillow 48439.0/50000: 97% mana heating_up, rune_of_power, gladiators_badge
3:31.129 rop_phase h pyroblast Fluffy_Pillow 47380.0/50000: 95% mana hot_streak, rune_of_power, gladiators_badge
3:32.291 rop_phase o fireball Fluffy_Pillow 47542.0/50000: 95% mana fireball, heating_up, rune_of_power
3:34.032 rop_phase o fireball Fluffy_Pillow 48283.0/50000: 97% mana fireball, heating_up, rune_of_power
3:35.773 rop_phase o fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power
3:37.515 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), rune_of_power
3:38.815 rop_phase j fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
3:39.258 rop_phase h pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak, rune_of_power
3:40.420 rop_phase o fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball, rune_of_power
3:42.161 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
3:43.902 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:45.643 standard_rotation s fire_blast Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:45.860 standard_rotation q pyroblast Fluffy_Pillow 48721.0/50000: 97% mana hot_streak
3:47.023 standard_rotation w scorch Fluffy_Pillow 48884.0/50000: 98% mana fireball
3:48.184 standard_rotation w scorch Fluffy_Pillow 49503.0/50000: 99% mana fireball
3:49.348 standard_rotation t pyroblast Fluffy_Pillow 49506.0/50000: 99% mana fireball, heating_up
3:50.520 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana fireball
3:51.681 standard_rotation w scorch Fluffy_Pillow 49503.0/50000: 99% mana fireball
3:52.844 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana fireball, heating_up
3:54.016 standard_rotation w scorch Fluffy_Pillow 49677.0/50000: 99% mana fireball, heating_up
3:54.016 standard_rotation s fire_blast Fluffy_Pillow 49677.0/50000: 99% mana fireball, heating_up
3:55.180 standard_rotation r pyroblast Fluffy_Pillow 49506.0/50000: 99% mana fireball, hot_streak
3:56.342 standard_rotation w scorch Fluffy_Pillow 49668.0/50000: 99% mana fireball
3:57.504 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana fireball
3:58.666 standard_rotation t pyroblast Fluffy_Pillow 49504.0/50000: 99% mana fireball, heating_up
3:59.841 default M mirror_image Fluffy_Pillow 49679.0/50000: 99% mana fireball
4:01.163 standard_rotation w scorch Fluffy_Pillow 50000.0/50000: 100% mana fireball
4:01.302 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball
4:02.326 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:03.499 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:04.661 default N use_item_dreadfire_vessel Fluffy_Pillow 49504.0/50000: 99% mana
4:04.661 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:05.824 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:06.995 standard_rotation w scorch Fluffy_Pillow 49676.0/50000: 99% mana
4:08.158 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:09.320 standard_rotation s fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:09.320 standard_rotation r pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
4:10.482 standard_rotation w scorch Fluffy_Pillow 49166.0/50000: 98% mana hot_streak
4:11.644 standard_rotation r pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak
4:12.807 standard_rotation w scorch Fluffy_Pillow 49667.0/50000: 99% mana
4:13.969 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:15.131 default O rune_of_power Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:16.295 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power, firestorm
4:16.744 rop_phase i fire_blast Fluffy_Pillow 49400.0/50000: 99% mana rune_of_power, firestorm
4:17.458 rop_phase g pyroblast Fluffy_Pillow 49663.0/50000: 99% mana hot_streak, rune_of_power, firestorm
4:18.620 rop_phase g pyroblast Fluffy_Pillow 49825.0/50000: 100% mana heating_up, rune_of_power, firestorm
4:19.785 rop_phase h pyroblast Fluffy_Pillow 49990.0/50000: 100% mana hot_streak, rune_of_power
4:20.948 rop_phase n scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
4:22.109 rop_phase n scorch Fluffy_Pillow 49503.0/50000: 99% mana rune_of_power
4:23.273 rop_phase l pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
4:24.446 rop_phase i fire_blast Fluffy_Pillow 49679.0/50000: 99% mana rune_of_power
4:24.465 rop_phase n scorch Fluffy_Pillow 49198.0/50000: 98% mana heating_up, rune_of_power
4:25.627 rop_phase l pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:26.799 rop_phase n scorch Fluffy_Pillow 49676.0/50000: 99% mana rune_of_power
4:27.961 rop_phase n scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
4:29.123 standard_rotation t pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:30.297 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:31.459 combustion_phase d fireball Fluffy_Pillow 49504.0/50000: 99% mana
4:32.759 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:32.759 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power
4:33.201 combustion_cooldowns U use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power
4:33.201 combustion_phase a pyroblast Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:34.363 combustion_phase a pyroblast Fluffy_Pillow 44104.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:35.526 combustion_phase c phoenix_flames Fluffy_Pillow 44267.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
4:36.689 combustion_phase a pyroblast Fluffy_Pillow 45430.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:37.853 combustion_phase c phoenix_flames Fluffy_Pillow 45594.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
4:39.015 combustion_phase a pyroblast Fluffy_Pillow 46756.0/50000: 94% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:39.915 combustion_phase V fire_blast Fluffy_Pillow 46656.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
4:40.178 combustion_phase a pyroblast Fluffy_Pillow 46419.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:41.341 combustion_phase c phoenix_flames Fluffy_Pillow 46582.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
4:42.505 combustion_phase a pyroblast Fluffy_Pillow 47746.0/50000: 95% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:43.668 combustion_phase f dragons_breath Fluffy_Pillow 47909.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
4:44.831 standard_rotation w scorch Fluffy_Pillow 47072.0/50000: 94% mana heating_up, gladiators_badge
4:45.993 standard_rotation t pyroblast Fluffy_Pillow 47734.0/50000: 95% mana heating_up, gladiators_badge
4:47.167 standard_rotation p pyroblast Fluffy_Pillow 47908.0/50000: 96% mana heating_up, firestorm, gladiators_badge
4:47.628 standard_rotation s fire_blast Fluffy_Pillow 47308.0/50000: 95% mana heating_up, firestorm, gladiators_badge
4:48.330 standard_rotation p pyroblast Fluffy_Pillow 47571.0/50000: 95% mana hot_streak, firestorm
4:49.493 standard_rotation p pyroblast Fluffy_Pillow 47734.0/50000: 95% mana heating_up, firestorm
4:50.655 standard_rotation p pyroblast Fluffy_Pillow 47896.0/50000: 96% mana hot_streak, firestorm
4:51.818 standard_rotation w scorch Fluffy_Pillow 48059.0/50000: 96% mana heating_up
4:52.981 standard_rotation t pyroblast Fluffy_Pillow 48722.0/50000: 97% mana heating_up
4:54.153 standard_rotation w scorch Fluffy_Pillow 48894.0/50000: 98% mana
4:55.314 standard_rotation w scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:56.477 standard_rotation s fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:56.477 standard_rotation r pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
4:57.640 standard_rotation w scorch Fluffy_Pillow 49168.0/50000: 98% mana
4:58.803 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:59.966 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
5:01.138 default O rune_of_power Fluffy_Pillow 49677.0/50000: 99% mana
5:02.452 rop_phase n scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
5:03.070 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
5:03.615 rop_phase l pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
5:04.787 rop_phase n scorch Fluffy_Pillow 49677.0/50000: 99% mana rune_of_power
5:05.949 rop_phase n scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
5:07.111 rop_phase l pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:08.283 rop_phase n scorch Fluffy_Pillow 49676.0/50000: 99% mana heating_up, rune_of_power
5:09.446 rop_phase l pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
5:10.620 rop_phase i fire_blast Fluffy_Pillow 49679.0/50000: 99% mana rune_of_power
5:10.791 rop_phase m phoenix_flames Fluffy_Pillow 49350.0/50000: 99% mana heating_up, rune_of_power
5:11.955 rop_phase n scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
5:13.119 rop_phase n scorch Fluffy_Pillow 49506.0/50000: 99% mana rune_of_power
5:14.282 rop_phase l pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
5:15.454 standard_rotation w scorch Fluffy_Pillow 49677.0/50000: 99% mana
5:16.616 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
5:17.777 standard_rotation t pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
5:18.952 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana
5:18.952 standard_rotation s fire_blast Fluffy_Pillow 49678.0/50000: 99% mana

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2018 1922 1508
Intellect 450 -3 1813 1632 1108 (132)
Spirit 0 0 0 0 0
Health 40360 38440 0
Mana 50000 50000 0
Spell Power 1813 1632 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="fire"
source=default
spec=fire
level=60
race=troll
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

gnome : 5184 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5184.1 5184.1 9.6 / 0.186% 812.4 / 15.7% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
808.4 803.4 Mana 0.00% 57.8 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
gnome 5184
Conflagration Flare Up 24 0.5% 29.9 9.68sec 237 0 Direct 29.9 150 376 237 38.6%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.95 29.95 0.00 0.00 0.0000 0.0000 7088.36 7088.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.43% 18.40 7 38 149.55 130 255 149.57 131 176 2752 2752 0.00%
crit 38.57% 11.55 2 23 375.53 260 510 375.94 260 474 4337 4337 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.8 92.75sec 3903 3395 Direct 0.8 0 3904 3904 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.84 0.84 0.00 0.00 1.1505 0.0000 3289.66 3289.66 0.00% 3394.91 3394.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.84 0 4 3903.60 3793 4403 2381.46 0 4403 3290 3290 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.84
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 157 3.0% 3.3 102.96sec 14316 0 Direct 3.3 11649 23350 14385 23.4%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.28 0.00 0.00 0.0000 0.0000 47233.64 47233.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.64% 2.52 0 4 11648.94 11342 12023 11507.87 0 12023 29322 29322 0.00%
crit 23.36% 0.77 0 4 23349.85 22685 24046 13464.54 0 24046 17911 17911 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 608 11.7% 42.7 7.08sec 4271 0 Direct 42.7 0 4271 4271 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.73 42.73 0.00 0.00 0.0000 0.0000 182509.57 182509.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.73 33 51 4271.45 3052 5987 4272.89 4008 4522 182510 182510 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:17.23
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:2.80
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.50
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.20
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 611 (639) 11.8% (12.3%) 77.2 3.40sec 2485 1510 Direct 77.2 (220.6) 1656 3450 2375 40.1% (40.1%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.18 77.18 0.00 0.00 1.6457 0.0000 183327.75 183327.75 0.00% 1510.23 1510.23
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.90% 46.23 26 65 1655.72 1440 2580 1656.20 1524 1813 76545 76545 0.00%
crit 40.10% 30.95 19 46 3450.35 2880 5650 3453.60 3238 3791 106783 106783 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.73
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:21.08
    standard_rotation
    [w]:51.42
    Conflagration 28 0.5% 77.2 3.40sec 110 0 Periodic 143.4 36 90 59 43.1% 68.4%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.18 0.00 143.39 143.39 0.0000 1.4326 8497.58 8497.58 0.00% 41.37 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 56.88% 81.56 54 111 35.65 0 57 35.64 34 38 2907 2907 0.00%
crit 43.12% 61.84 38 88 90.42 0 125 90.50 84 98 5590 5590 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 986 19.0% 268.0 1.12sec 1104 0 Periodic 299.2 989 0 989 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 268.03 0.00 299.20 299.20 0.0000 1.0000 295805.18 295805.18 0.00% 988.65 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 988.65 152 3089 989.81 871 1162 295805 295805 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.43sec 3744 4886

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7663 0.0000 0.00 0.00 0.00% 4886.46 4886.46

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 99  / 37 0.7% 241.1 3.39sec 46 34 Direct 240.3 37 75 47 24.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 241.09 240.32 0.00 0.00 1.3878 0.0000 11209.55 11209.55 0.00% 33.50 33.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.56% 181.59 118 213 37.49 29 53 37.57 35 41 6809 6809 0.00%
crit 24.44% 58.73 29 84 74.91 57 106 75.10 66 86 4401 4401 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:83.40
Phoenix Flames 0 (243) 0.0% (4.7%) 14.1 21.62sec 5150 4714

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.14 0.00 0.00 0.00 1.0924 0.0000 0.00 0.00 0.00% 4714.49 4714.49

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.40
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.45
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.28
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 243 4.7% 14.1 21.61sec 5162 0 Direct 14.1 2151 5997 5163 78.3%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 0.00 0.00 0.0000 0.0000 72801.21 72801.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.70% 3.06 0 8 2151.50 1734 3402 2112.15 0 3106 6581 6581 0.00%
crit 78.30% 11.04 6 16 5996.75 3468 6803 6002.10 5121 6409 66220 66220 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2131 (2264) 41.1% (43.7%) 98.9 3.06sec 6865 6207 Direct 99.6 (279.1) 3024 7832 6420 70.6% (70.6%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.95 99.64 0.00 0.00 1.1060 0.0000 639603.50 639603.50 0.00% 6206.80 6206.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 29.38% 29.28 16 47 3024.28 2626 5152 3023.99 2779 3311 88547 88547 0.00%
crit 70.62% 70.37 44 109 7831.59 5252 10303 7855.32 7124 8765 551056 551056 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.77
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:27.69
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:4.02
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.94
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:8.30
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.24
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.58
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.17
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.23
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:11.01
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.5% 99.6 3.06sec 398 0 Periodic 179.5 137 350 221 39.6% 86.7%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.64 0.00 179.50 179.50 0.0000 1.4517 39655.93 39655.93 0.00% 152.18 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.44% 108.50 74 151 136.64 9 234 136.67 129 144 14826 14826 0.00%
crit 39.56% 71.00 49 99 349.75 19 469 350.22 324 377 24830 24830 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 215 4.2% 34.4 7.70sec 1881 1648 Direct 34.4 0 1882 1882 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.40 34.40 0.00 0.00 1.1414 0.0000 64729.68 64729.68 0.00% 1648.32 1648.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 34.40 17 52 1881.94 1153 3345 1883.74 1680 2151 64730 64730 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:4.52
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:7.68
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.55
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
gnome
Combustion 4.7 70.09sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.71
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:gnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:gnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.16 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.16
Rune of Power 5.2 61.90sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.15 0.00 0.00 0.00 1.0993 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.19
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.0sec 70.0sec 11.8sec 18.56% 0.00% 106.6 (106.6) 4.6

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:49.8s / 88.3s
  • trigger_min/max:49.8s / 88.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • combustion_1:18.56%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.5 24.7 9.1sec 4.2sec 5.0sec 36.26% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.6s / 49.5s
  • trigger_min/max:1.3s / 45.5s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 28.8s

Stack Uptimes

  • fireball_1:20.28%
  • fireball_2:8.91%
  • fireball_3:4.37%
  • fireball_4:1.88%
  • fireball_5:0.65%
  • fireball_6:0.15%
  • fireball_7:0.02%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 8.0 0.8 35.8sec 32.0sec 4.2sec 11.20% 0.00% 0.8 (0.8) 7.8

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 166.1s
  • trigger_min/max:0.8s / 166.1s
  • trigger_pct:10.15%
  • duration_min/max:0.0s / 14.5s

Stack Uptimes

  • firestorm_1:11.20%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 70.4sec 72.1sec 14.7sec 23.09% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 88.3s
  • trigger_min/max:60.0s / 88.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:23.09%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 98.7 0.0 3.0sec 3.0sec 1.1sec 36.50% 46.64% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.5s
  • trigger_min/max:0.2s / 19.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.3s

Stack Uptimes

  • heating_up_1:36.50%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 86.3 0.0 3.5sec 3.5sec 0.6sec 12.34% 86.35% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 29.6s
  • trigger_min/max:0.5s / 29.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s

Stack Uptimes

  • hot_streak_1:12.34%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 314.8sec 0.0sec 23.6sec 9.11% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.4s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.11%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.7 0.2 32.2sec 31.6sec 11.9sec 38.45% 0.00% 0.2 (0.2) 9.3

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 70.7s
  • trigger_min/max:3.6s / 70.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.7s

Stack Uptimes

  • rune_of_power_1:38.45%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 98.7 75.0 126.0 3.0s 0.2s 19.5s
Heating Up removed 12.0 2.0 25.0 22.9s 0.9s 192.3s
Heating Up converted with Fire Blast 23.3 13.0 33.0 12.1s 0.5s 96.4s
Hot Streak procs 86.3 64.0 113.0 3.5s 0.5s 29.6s
Hot Streak spells used 268.1 215.0 322.0 1.1s 0.0s 5.3s
Hot Streak spell crits 189.5 146.0 242.0 1.6s 0.0s 16.6s
Hot Streak spell crits wasted 4.6 0.0 12.0 65.5s 0.1s 344.7s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 13.30% 9.16% 17.01% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3190.00013.6460.9590.00014.503
Rune of Power15.5910.00039.11482.91026.162129.319
Fire Blast0.0930.00026.3053.9841.30031.708
Dragon's Breath139.66345.266309.718285.621196.518359.744
Combustion2.1991.30011.56410.4185.59722.678
Phoenix Flames0.1910.00027.4232.7051.72138.411

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
gnome
mana_regen Mana 2186.75 241396.87 100.00% 110.39 58761.42 19.58%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 51500.0 803.35 808.44 58771.5 50972.0 44724.0 52500.0
Usage Type Count Total Avg RPE APR
gnome
combustion Mana 4.7 23554.5 5000.0 5002.9 0.0
dragons_breath Mana 0.8 1684.9 2000.0 1999.3 2.0
fire_blast Mana 42.7 21366.1 500.0 500.0 8.5
fireball Mana 77.2 77199.1 1000.0 1000.2 2.5
mirror_image Mana 3.0 1994.2 666.0 666.0 5.6
pyroblast Mana 99.9 99949.8 1000.0 1010.1 6.8
scorch Mana 34.4 17189.8 500.0 499.6 3.8

Statistics & Data Analysis

Fight Length
gnome Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
gnome Damage Per Second
Count 1717
Mean 5184.14
Minimum 4654.38
Maximum 5988.22
Spread ( max - min ) 1333.84
Range [ ( max - min ) / 2 * 100% ] 12.86%
Standard Deviation 203.3283
5th Percentile 4863.53
95th Percentile 5542.94
( 95th Percentile - 5th Percentile ) 679.41
Mean Distribution
Standard Deviation 4.9070
95.00% Confidence Interval ( 5174.52 - 5193.76 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5910
0.1 Scale Factor Error with Delta=300 353
0.05 Scale Factor Error with Delta=300 1412
0.01 Scale Factor Error with Delta=300 35293
Priority Target DPS
gnome Priority Target Damage Per Second
Count 1717
Mean 5184.14
Minimum 4654.38
Maximum 5988.22
Spread ( max - min ) 1333.84
Range [ ( max - min ) / 2 * 100% ] 12.86%
Standard Deviation 203.3283
5th Percentile 4863.53
95th Percentile 5542.94
( 95th Percentile - 5th Percentile ) 679.41
Mean Distribution
Standard Deviation 4.9070
95.00% Confidence Interval ( 5174.52 - 5193.76 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5910
0.1 Scale Factor Error with Delta=300 353
0.05 Scale Factor Error with Delta=300 1412
0.01 Scale Factor Error with Delta=300 35293
DPS(e)
gnome Damage Per Second (Effective)
Count 1717
Mean 5184.14
Minimum 4654.38
Maximum 5988.22
Spread ( max - min ) 1333.84
Range [ ( max - min ) / 2 * 100% ] 12.86%
Damage
gnome Damage
Count 1717
Mean 1544542.08
Minimum 1206939.93
Maximum 1963737.29
Spread ( max - min ) 756797.36
Range [ ( max - min ) / 2 * 100% ] 24.50%
DTPS
gnome Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
gnome Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
gnome Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
gnome Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
gnome Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
gnome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
gnomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
gnome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.19 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.16 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.70 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 17.23 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.71 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.77 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 27.69 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 4.02 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.40 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.73 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 4.52 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.84 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.94 pyroblast,if=buff.firestorm.react
g 8.30 pyroblast,if=buff.hot_streak.react
h 2.80 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.50 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.24 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.45 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 7.68 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 21.08 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.58 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.17 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.23 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.20 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 11.01 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.28 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.55 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.42 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUZUZbZbZUZdadaUZOnnnnNnnnnhnfoowrpwrpwwwwwwwrpwwwwrpooowoowoocWTZZUZUZUZbZbZUZbOnnnnignnnrpwwpwrpwwwwrpwNwooowrpwMwwwwwwwwcWTZZUZUZUZbZbZUZeOlngnnignigfoowpwwrpwwwrpooowpwwrpwwwwwwwwcWUTbZUZUZbZdaUZdaOnnghmmNkmmigmtvvsvrqvMvsvvrqvvsoorovsoooqvrsvsvsooocWTZZUZUZbZbZdUZZOffmkhmmkfffghvtvvsvrsvvsvvrqooNoo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask gnome 52500.0/52500: 100% mana
Pre precombat 1 food gnome 52500.0/52500: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 52500.0/52500: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 52500.0/52500: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 51500.0/52500: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 51500.0/52500: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 51500.0/52500: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 52500.0/52500: 100% mana bloodlust, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 47500.0/52500: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.724 combustion_phase b phoenix_flames Fluffy_Pillow 46424.0/52500: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.611 combustion_phase Z pyroblast Fluffy_Pillow 47311.0/52500: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.611 combustion_phase U fire_blast Fluffy_Pillow 46311.0/52500: 88% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.497 combustion_phase Z pyroblast Fluffy_Pillow 46697.0/52500: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.497 combustion_phase U fire_blast Fluffy_Pillow 45697.0/52500: 87% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.382 combustion_phase Z pyroblast Fluffy_Pillow 46082.0/52500: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.271 combustion_phase b phoenix_flames Fluffy_Pillow 45971.0/52500: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.157 combustion_phase Z pyroblast Fluffy_Pillow 46857.0/52500: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.044 combustion_phase b phoenix_flames Fluffy_Pillow 46744.0/52500: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.930 combustion_phase Z pyroblast Fluffy_Pillow 47630.0/52500: 91% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.930 combustion_phase U fire_blast Fluffy_Pillow 46630.0/52500: 89% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.816 combustion_phase Z pyroblast Fluffy_Pillow 47016.0/52500: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.702 combustion_phase d scorch Fluffy_Pillow 46902.0/52500: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.590 combustion_phase a pyroblast Fluffy_Pillow 47290.0/52500: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.486 combustion_phase d scorch Fluffy_Pillow 47186.0/52500: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.371 combustion_phase a pyroblast Fluffy_Pillow 47571.0/52500: 91% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.083 combustion_phase U fire_blast Fluffy_Pillow 47283.0/52500: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.268 combustion_phase Z pyroblast Fluffy_Pillow 46968.0/52500: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:14.155 default O rune_of_power Fluffy_Pillow 46855.0/52500: 89% mana bloodlust, heating_up, gladiators_badge, potion_of_spectral_intellect
0:15.042 rop_phase n fireball Fluffy_Pillow 47742.0/52500: 91% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:16.371 rop_phase n fireball Fluffy_Pillow 48071.0/52500: 92% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:17.699 rop_phase n fireball Fluffy_Pillow 48399.0/52500: 92% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:19.025 rop_phase n fireball Fluffy_Pillow 48725.0/52500: 93% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:20.351 default N use_item_dreadfire_vessel Fluffy_Pillow 49051.0/52500: 93% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:20.351 rop_phase n fireball Fluffy_Pillow 49051.0/52500: 93% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:21.680 rop_phase n fireball Fluffy_Pillow 49380.0/52500: 94% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:23.007 rop_phase n fireball Fluffy_Pillow 49707.0/52500: 95% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:24.336 rop_phase n fireball Fluffy_Pillow 50036.0/52500: 95% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:24.836 rop_phase h fire_blast Fluffy_Pillow 50536.0/52500: 96% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:25.664 rop_phase n fireball Fluffy_Pillow 49864.0/52500: 95% mana bloodlust, hot_streak, rune_of_power, firestorm
0:26.992 rop_phase f pyroblast Fluffy_Pillow 50192.0/52500: 96% mana bloodlust, fireball, hot_streak, rune_of_power, firestorm
0:27.879 standard_rotation o pyroblast Fluffy_Pillow 50079.0/52500: 95% mana bloodlust, fireball(2), heating_up, firestorm
0:28.766 standard_rotation o pyroblast Fluffy_Pillow 49966.0/52500: 95% mana bloodlust, fireball(2), hot_streak, firestorm
0:29.652 standard_rotation w fireball Fluffy_Pillow 49852.0/52500: 95% mana bloodlust, fireball(2), heating_up
0:30.552 standard_rotation r fire_blast Fluffy_Pillow 50752.0/52500: 97% mana bloodlust, fireball(2), heating_up
0:30.979 standard_rotation p pyroblast Fluffy_Pillow 49679.0/52500: 95% mana bloodlust, fireball(2), hot_streak
0:31.866 standard_rotation w fireball Fluffy_Pillow 49566.0/52500: 94% mana bloodlust, heating_up
0:32.766 standard_rotation r fire_blast Fluffy_Pillow 50466.0/52500: 96% mana bloodlust, heating_up
0:33.191 standard_rotation p pyroblast Fluffy_Pillow 49391.0/52500: 94% mana bloodlust, hot_streak
0:34.078 standard_rotation w fireball Fluffy_Pillow 49278.0/52500: 94% mana bloodlust, fireball
0:35.405 standard_rotation w fireball Fluffy_Pillow 49605.0/52500: 94% mana bloodlust, fireball
0:36.733 standard_rotation w fireball Fluffy_Pillow 49933.0/52500: 95% mana bloodlust, fireball(2)
0:38.061 standard_rotation w fireball Fluffy_Pillow 50261.0/52500: 96% mana bloodlust, fireball(3)
0:39.388 standard_rotation w fireball Fluffy_Pillow 50588.0/52500: 96% mana bloodlust, fireball(4)
0:40.714 standard_rotation w fireball Fluffy_Pillow 50914.0/52500: 97% mana bloodlust, fireball(5)
0:42.041 standard_rotation w fireball Fluffy_Pillow 51241.0/52500: 98% mana fireball(6)
0:43.641 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up
0:43.764 standard_rotation p pyroblast Fluffy_Pillow 51123.0/52500: 97% mana hot_streak
0:44.914 standard_rotation w fireball Fluffy_Pillow 51273.0/52500: 98% mana fireball
0:46.639 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball
0:48.364 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(2)
0:50.089 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(3)
0:51.489 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up
0:51.812 standard_rotation p pyroblast Fluffy_Pillow 51323.0/52500: 98% mana hot_streak, firestorm
0:52.963 standard_rotation o pyroblast Fluffy_Pillow 51474.0/52500: 98% mana fireball, heating_up, firestorm
0:54.114 standard_rotation o pyroblast Fluffy_Pillow 51625.0/52500: 98% mana fireball, hot_streak, firestorm
0:55.265 standard_rotation o pyroblast Fluffy_Pillow 51776.0/52500: 99% mana fireball, heating_up, firestorm
0:56.416 standard_rotation w fireball Fluffy_Pillow 51927.0/52500: 99% mana fireball, hot_streak, firestorm
0:58.140 standard_rotation o pyroblast Fluffy_Pillow 51504.0/52500: 98% mana fireball, hot_streak, firestorm
0:59.290 standard_rotation o pyroblast Fluffy_Pillow 51654.0/52500: 98% mana fireball(2), heating_up, firestorm
1:00.441 standard_rotation w fireball Fluffy_Pillow 51805.0/52500: 99% mana fireball(2), hot_streak, firestorm
1:02.164 standard_rotation o pyroblast Fluffy_Pillow 51503.0/52500: 98% mana fireball(2), hot_streak, firestorm
1:03.315 standard_rotation o pyroblast Fluffy_Pillow 51654.0/52500: 98% mana fireball(3), heating_up, firestorm
1:04.465 combustion_phase c fireball Fluffy_Pillow 51804.0/52500: 99% mana fireball(3), hot_streak
1:05.765 combustion_phase W combustion Fluffy_Pillow 52500.0/52500: 100% mana fireball(3), hot_streak
1:06.189 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 46924.0/52500: 89% mana combustion, fireball(3), hot_streak, rune_of_power
1:06.189 combustion_phase Z pyroblast Fluffy_Pillow 46924.0/52500: 89% mana combustion, fireball(3), hot_streak, rune_of_power, gladiators_badge
1:07.340 combustion_phase Z pyroblast Fluffy_Pillow 47075.0/52500: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:07.340 combustion_phase U fire_blast Fluffy_Pillow 46075.0/52500: 88% mana combustion, rune_of_power, gladiators_badge
1:08.489 combustion_phase Z pyroblast Fluffy_Pillow 46724.0/52500: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:08.489 combustion_phase U fire_blast Fluffy_Pillow 45724.0/52500: 87% mana combustion, rune_of_power, gladiators_badge
1:09.638 combustion_phase Z pyroblast Fluffy_Pillow 46373.0/52500: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:09.638 combustion_phase U fire_blast Fluffy_Pillow 45373.0/52500: 86% mana combustion, rune_of_power, gladiators_badge
1:10.788 combustion_phase Z pyroblast Fluffy_Pillow 46023.0/52500: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:11.939 combustion_phase b phoenix_flames Fluffy_Pillow 46174.0/52500: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
1:13.091 combustion_phase Z pyroblast Fluffy_Pillow 47326.0/52500: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:14.242 combustion_phase b phoenix_flames Fluffy_Pillow 47477.0/52500: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
1:15.393 combustion_phase Z pyroblast Fluffy_Pillow 48628.0/52500: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:15.393 combustion_phase U fire_blast Fluffy_Pillow 47628.0/52500: 91% mana combustion, rune_of_power, gladiators_badge
1:16.544 combustion_phase Z pyroblast Fluffy_Pillow 48279.0/52500: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:17.693 combustion_phase b phoenix_flames Fluffy_Pillow 48428.0/52500: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
1:18.842 default O rune_of_power Fluffy_Pillow 49577.0/52500: 94% mana gladiators_badge
1:19.992 rop_phase n fireball Fluffy_Pillow 50727.0/52500: 97% mana rune_of_power, gladiators_badge
1:21.717 rop_phase n fireball Fluffy_Pillow 51452.0/52500: 98% mana rune_of_power
1:23.441 rop_phase n fireball Fluffy_Pillow 51504.0/52500: 98% mana fireball, rune_of_power
1:25.167 rop_phase n fireball Fluffy_Pillow 51506.0/52500: 98% mana fireball(2), rune_of_power
1:26.567 rop_phase i fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up, rune_of_power
1:26.893 rop_phase g pyroblast Fluffy_Pillow 51326.0/52500: 98% mana hot_streak, rune_of_power
1:28.044 rop_phase n fireball Fluffy_Pillow 51477.0/52500: 98% mana fireball, rune_of_power
1:29.768 rop_phase n fireball Fluffy_Pillow 51504.0/52500: 98% mana fireball, rune_of_power
1:31.495 rop_phase n fireball Fluffy_Pillow 51507.0/52500: 98% mana fireball(2), rune_of_power
1:32.795 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up
1:33.219 standard_rotation p pyroblast Fluffy_Pillow 51424.0/52500: 98% mana hot_streak
1:34.370 standard_rotation w fireball Fluffy_Pillow 51575.0/52500: 98% mana fireball, heating_up
1:36.094 standard_rotation w fireball Fluffy_Pillow 51504.0/52500: 98% mana fireball, heating_up
1:37.818 standard_rotation p pyroblast Fluffy_Pillow 51504.0/52500: 98% mana hot_streak
1:38.969 standard_rotation w fireball Fluffy_Pillow 51655.0/52500: 98% mana fireball, heating_up
1:40.269 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana fireball, heating_up
1:40.692 standard_rotation p pyroblast Fluffy_Pillow 51423.0/52500: 98% mana fireball, hot_streak
1:41.843 standard_rotation w fireball Fluffy_Pillow 51574.0/52500: 98% mana fireball(2), heating_up
1:43.568 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(2), heating_up
1:45.292 standard_rotation w fireball Fluffy_Pillow 51504.0/52500: 98% mana fireball(3)
1:47.018 standard_rotation w fireball Fluffy_Pillow 51506.0/52500: 98% mana fireball(4)
1:48.618 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up
1:48.743 standard_rotation p pyroblast Fluffy_Pillow 51125.0/52500: 97% mana hot_streak
1:49.894 standard_rotation w fireball Fluffy_Pillow 51276.0/52500: 98% mana heating_up
1:51.619 default N use_item_dreadfire_vessel Fluffy_Pillow 51505.0/52500: 98% mana heating_up
1:51.619 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana heating_up
1:53.343 standard_rotation o pyroblast Fluffy_Pillow 51504.0/52500: 98% mana hot_streak, firestorm
1:54.492 standard_rotation o pyroblast Fluffy_Pillow 51653.0/52500: 98% mana fireball, heating_up, firestorm
1:55.643 standard_rotation o pyroblast Fluffy_Pillow 51804.0/52500: 99% mana fireball, hot_streak, firestorm
1:56.793 standard_rotation w fireball Fluffy_Pillow 51954.0/52500: 99% mana fireball, heating_up
1:58.093 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana fireball, heating_up
1:58.518 standard_rotation p pyroblast Fluffy_Pillow 51425.0/52500: 98% mana fireball, hot_streak
1:59.667 standard_rotation w fireball Fluffy_Pillow 51574.0/52500: 98% mana heating_up
2:01.392 default M mirror_image Fluffy_Pillow 51505.0/52500: 98% mana heating_up
2:02.540 standard_rotation w fireball Fluffy_Pillow 51653.0/52500: 98% mana fireball
2:04.265 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball
2:05.990 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana heating_up
2:07.715 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball
2:09.440 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(2)
2:11.163 standard_rotation w fireball Fluffy_Pillow 51503.0/52500: 98% mana fireball(3)
2:12.886 standard_rotation w fireball Fluffy_Pillow 51503.0/52500: 98% mana fireball(4)
2:14.610 standard_rotation w fireball Fluffy_Pillow 51504.0/52500: 98% mana fireball(5)
2:16.334 combustion_phase c fireball Fluffy_Pillow 51504.0/52500: 98% mana heating_up
2:17.634 combustion_phase W combustion Fluffy_Pillow 52500.0/52500: 100% mana hot_streak
2:18.058 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 46924.0/52500: 89% mana combustion, hot_streak, rune_of_power
2:18.058 combustion_phase Z pyroblast Fluffy_Pillow 46924.0/52500: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:19.209 combustion_phase Z pyroblast Fluffy_Pillow 47075.0/52500: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:19.209 combustion_phase U fire_blast Fluffy_Pillow 46075.0/52500: 88% mana combustion, rune_of_power, gladiators_badge
2:20.358 combustion_phase Z pyroblast Fluffy_Pillow 46724.0/52500: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:20.358 combustion_phase U fire_blast Fluffy_Pillow 45724.0/52500: 87% mana combustion, rune_of_power, gladiators_badge
2:21.508 combustion_phase Z pyroblast Fluffy_Pillow 46374.0/52500: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:21.508 combustion_phase U fire_blast Fluffy_Pillow 45374.0/52500: 86% mana combustion, rune_of_power, gladiators_badge
2:22.659 combustion_phase Z pyroblast Fluffy_Pillow 46025.0/52500: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.808 combustion_phase b phoenix_flames Fluffy_Pillow 46174.0/52500: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
2:24.959 combustion_phase Z pyroblast Fluffy_Pillow 47325.0/52500: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:26.110 combustion_phase b phoenix_flames Fluffy_Pillow 47476.0/52500: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
2:27.261 combustion_phase Z pyroblast Fluffy_Pillow 48627.0/52500: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:27.261 combustion_phase U fire_blast Fluffy_Pillow 47627.0/52500: 91% mana combustion, rune_of_power, gladiators_badge
2:28.412 combustion_phase Z pyroblast Fluffy_Pillow 48278.0/52500: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:29.564 combustion_phase e dragons_breath Fluffy_Pillow 48430.0/52500: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:30.716 default O rune_of_power Fluffy_Pillow 47582.0/52500: 91% mana heating_up, gladiators_badge
2:31.864 rop_phase l phoenix_flames Fluffy_Pillow 48730.0/52500: 93% mana heating_up, rune_of_power, gladiators_badge
2:33.014 rop_phase n fireball Fluffy_Pillow 49880.0/52500: 95% mana hot_streak, rune_of_power, gladiators_badge
2:34.739 rop_phase g pyroblast Fluffy_Pillow 50605.0/52500: 96% mana hot_streak, rune_of_power
2:35.889 rop_phase n fireball Fluffy_Pillow 50755.0/52500: 97% mana fireball, rune_of_power
2:37.613 rop_phase n fireball Fluffy_Pillow 51479.0/52500: 98% mana fireball, rune_of_power
2:39.113 rop_phase i fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up, rune_of_power
2:39.337 rop_phase g pyroblast Fluffy_Pillow 51224.0/52500: 98% mana hot_streak, rune_of_power
2:40.490 rop_phase n fireball Fluffy_Pillow 51377.0/52500: 98% mana heating_up, rune_of_power
2:42.142 rop_phase i fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up, rune_of_power
2:42.213 rop_phase g pyroblast Fluffy_Pillow 51071.0/52500: 97% mana hot_streak, rune_of_power, firestorm
2:43.365 rop_phase f pyroblast Fluffy_Pillow 51223.0/52500: 98% mana fireball, heating_up, rune_of_power, firestorm
2:44.515 standard_rotation o pyroblast Fluffy_Pillow 51373.0/52500: 98% mana fireball, hot_streak, firestorm
2:45.666 standard_rotation o pyroblast Fluffy_Pillow 51524.0/52500: 98% mana fireball, heating_up, firestorm
2:46.818 standard_rotation w fireball Fluffy_Pillow 51676.0/52500: 98% mana fireball, hot_streak
2:48.542 standard_rotation p pyroblast Fluffy_Pillow 51504.0/52500: 98% mana fireball, hot_streak
2:49.692 standard_rotation w fireball Fluffy_Pillow 51654.0/52500: 98% mana fireball(2)
2:51.417 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(2)
2:53.117 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up
2:53.141 standard_rotation p pyroblast Fluffy_Pillow 51024.0/52500: 97% mana hot_streak
2:54.291 standard_rotation w fireball Fluffy_Pillow 51174.0/52500: 97% mana fireball
2:56.015 standard_rotation w fireball Fluffy_Pillow 51504.0/52500: 98% mana fireball
2:57.740 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(2)
2:59.240 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up
2:59.464 standard_rotation p pyroblast Fluffy_Pillow 51224.0/52500: 98% mana hot_streak, firestorm
3:00.615 standard_rotation o pyroblast Fluffy_Pillow 51375.0/52500: 98% mana fireball, heating_up, firestorm
3:01.766 standard_rotation o pyroblast Fluffy_Pillow 51526.0/52500: 98% mana fireball, hot_streak, firestorm
3:02.916 standard_rotation o pyroblast Fluffy_Pillow 51676.0/52500: 98% mana fireball, heating_up, firestorm
3:04.066 standard_rotation w fireball Fluffy_Pillow 51826.0/52500: 99% mana fireball, hot_streak
3:05.790 standard_rotation p pyroblast Fluffy_Pillow 51504.0/52500: 98% mana fireball, hot_streak
3:06.941 standard_rotation w fireball Fluffy_Pillow 51655.0/52500: 98% mana fireball(2)
3:08.667 standard_rotation w fireball Fluffy_Pillow 51506.0/52500: 98% mana fireball(2)
3:09.967 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana heating_up
3:10.392 standard_rotation p pyroblast Fluffy_Pillow 51425.0/52500: 98% mana hot_streak
3:11.542 standard_rotation w fireball Fluffy_Pillow 51575.0/52500: 98% mana fireball
3:13.270 standard_rotation w fireball Fluffy_Pillow 51508.0/52500: 98% mana fireball
3:14.996 standard_rotation w fireball Fluffy_Pillow 51506.0/52500: 98% mana fireball(2)
3:16.720 standard_rotation w fireball Fluffy_Pillow 51504.0/52500: 98% mana fireball(3)
3:18.445 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(4)
3:20.171 standard_rotation w fireball Fluffy_Pillow 51506.0/52500: 98% mana heating_up
3:21.896 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball
3:23.621 standard_rotation w fireball Fluffy_Pillow 51505.0/52500: 98% mana fireball(2)
3:25.347 combustion_phase c fireball Fluffy_Pillow 51506.0/52500: 98% mana heating_up
3:26.647 combustion_phase W combustion Fluffy_Pillow 52500.0/52500: 100% mana fireball
3:26.647 combustion_phase U fire_blast Fluffy_Pillow 47500.0/52500: 90% mana combustion, fireball, rune_of_power
3:27.072 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 46425.0/52500: 88% mana combustion, fireball, heating_up, rune_of_power
3:27.072 combustion_phase b phoenix_flames Fluffy_Pillow 46425.0/52500: 88% mana combustion, fireball, heating_up, rune_of_power, gladiators_badge
3:28.222 combustion_phase Z pyroblast Fluffy_Pillow 47575.0/52500: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:28.222 combustion_phase U fire_blast Fluffy_Pillow 46575.0/52500: 89% mana combustion, rune_of_power, gladiators_badge
3:29.372 combustion_phase Z pyroblast Fluffy_Pillow 47225.0/52500: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:29.372 combustion_phase U fire_blast Fluffy_Pillow 46225.0/52500: 88% mana combustion, rune_of_power, gladiators_badge
3:30.521 combustion_phase Z pyroblast Fluffy_Pillow 46874.0/52500: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:31.672 combustion_phase b phoenix_flames Fluffy_Pillow 47025.0/52500: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:32.823 combustion_phase Z pyroblast Fluffy_Pillow 48176.0/52500: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:33.973 combustion_phase d scorch Fluffy_Pillow 48326.0/52500: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:35.122 combustion_phase a pyroblast Fluffy_Pillow 48975.0/52500: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
3:35.734 combustion_phase U fire_blast Fluffy_Pillow 48587.0/52500: 93% mana combustion, rune_of_power, gladiators_badge
3:36.284 combustion_phase Z pyroblast Fluffy_Pillow 48637.0/52500: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:37.435 combustion_phase d scorch Fluffy_Pillow 48788.0/52500: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
3:38.586 combustion_phase a pyroblast Fluffy_Pillow 49439.0/52500: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
3:39.747 default O rune_of_power Fluffy_Pillow 49600.0/52500: 94% mana heating_up, gladiators_badge
3:40.896 rop_phase n fireball Fluffy_Pillow 50749.0/52500: 97% mana heating_up, rune_of_power, gladiators_badge
3:42.620 rop_phase n fireball Fluffy_Pillow 51473.0/52500: 98% mana heating_up, rune_of_power
3:44.344 rop_phase g pyroblast Fluffy_Pillow 51504.0/52500: 98% mana hot_streak, rune_of_power
3:44.344 rop_phase h fire_blast Fluffy_Pillow 50504.0/52500: 96% mana rune_of_power
3:45.495 rop_phase m scorch Fluffy_Pillow 51155.0/52500: 97% mana fireball, rune_of_power
3:46.645 rop_phase m scorch Fluffy_Pillow 51805.0/52500: 99% mana fireball, rune_of_power
3:47.795 default N use_item_dreadfire_vessel Fluffy_Pillow 52004.0/52500: 99% mana fireball, heating_up, rune_of_power
3:47.795 rop_phase k pyroblast Fluffy_Pillow 52004.0/52500: 99% mana fireball, heating_up, rune_of_power
3:48.955 rop_phase m scorch Fluffy_Pillow 52164.0/52500: 99% mana fireball, rune_of_power
3:50.105 rop_phase m scorch Fluffy_Pillow 52004.0/52500: 99% mana fireball, rune_of_power
3:51.254 rop_phase i fire_blast Fluffy_Pillow 52003.0/52500: 99% mana fireball, heating_up, rune_of_power
3:51.254 rop_phase g pyroblast Fluffy_Pillow 51503.0/52500: 98% mana fireball, hot_streak, rune_of_power
3:52.404 rop_phase m scorch Fluffy_Pillow 51653.0/52500: 98% mana fireball, rune_of_power
3:53.554 standard_rotation t phoenix_flames Fluffy_Pillow 52004.0/52500: 99% mana fireball
3:54.704 standard_rotation v scorch Fluffy_Pillow 52500.0/52500: 100% mana fireball
3:55.855 standard_rotation v scorch Fluffy_Pillow 52005.0/52500: 99% mana fireball
3:57.006 standard_rotation s pyroblast Fluffy_Pillow 52005.0/52500: 99% mana fireball, heating_up
3:58.166 standard_rotation v scorch Fluffy_Pillow 52165.0/52500: 99% mana fireball, heating_up
3:59.317 standard_rotation r fire_blast Fluffy_Pillow 52005.0/52500: 99% mana fireball, heating_up
3:59.317 standard_rotation q pyroblast Fluffy_Pillow 51505.0/52500: 98% mana fireball, hot_streak
4:00.466 standard_rotation v scorch Fluffy_Pillow 51654.0/52500: 98% mana
4:01.616 default M mirror_image Fluffy_Pillow 52004.0/52500: 99% mana
4:02.766 standard_rotation v scorch Fluffy_Pillow 52154.0/52500: 99% mana heating_up
4:03.916 standard_rotation s pyroblast Fluffy_Pillow 52004.0/52500: 99% mana heating_up
4:05.078 standard_rotation v scorch Fluffy_Pillow 52166.0/52500: 99% mana
4:06.229 standard_rotation v scorch Fluffy_Pillow 52005.0/52500: 99% mana
4:07.380 standard_rotation r fire_blast Fluffy_Pillow 52005.0/52500: 99% mana heating_up
4:07.380 standard_rotation q pyroblast Fluffy_Pillow 51505.0/52500: 98% mana hot_streak
4:08.531 standard_rotation v scorch Fluffy_Pillow 51656.0/52500: 98% mana
4:09.682 standard_rotation v scorch Fluffy_Pillow 52005.0/52500: 99% mana
4:10.833 standard_rotation s pyroblast Fluffy_Pillow 52005.0/52500: 99% mana heating_up
4:11.993 standard_rotation o pyroblast Fluffy_Pillow 52165.0/52500: 99% mana heating_up, firestorm
4:13.143 standard_rotation o pyroblast Fluffy_Pillow 52315.0/52500: 100% mana hot_streak, firestorm
4:13.943 standard_rotation r fire_blast Fluffy_Pillow 52115.0/52500: 99% mana heating_up, firestorm
4:14.292 standard_rotation o pyroblast Fluffy_Pillow 51964.0/52500: 99% mana hot_streak, firestorm
4:15.444 standard_rotation v scorch Fluffy_Pillow 52116.0/52500: 99% mana heating_up
4:16.595 standard_rotation s pyroblast Fluffy_Pillow 52005.0/52500: 99% mana heating_up
4:17.756 standard_rotation o pyroblast Fluffy_Pillow 52166.0/52500: 99% mana heating_up, firestorm
4:18.905 standard_rotation o pyroblast Fluffy_Pillow 52315.0/52500: 100% mana hot_streak, firestorm
4:20.056 standard_rotation o pyroblast Fluffy_Pillow 52466.0/52500: 100% mana heating_up, firestorm
4:21.206 standard_rotation q pyroblast Fluffy_Pillow 52500.0/52500: 100% mana hot_streak
4:22.357 standard_rotation v scorch Fluffy_Pillow 52500.0/52500: 100% mana
4:22.357 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana
4:23.507 standard_rotation s pyroblast Fluffy_Pillow 52004.0/52500: 99% mana heating_up
4:24.668 standard_rotation v scorch Fluffy_Pillow 52165.0/52500: 99% mana heating_up
4:25.819 standard_rotation s pyroblast Fluffy_Pillow 52005.0/52500: 99% mana heating_up
4:26.979 standard_rotation v scorch Fluffy_Pillow 52165.0/52500: 99% mana heating_up
4:28.129 standard_rotation s pyroblast Fluffy_Pillow 52004.0/52500: 99% mana heating_up
4:29.290 standard_rotation o pyroblast Fluffy_Pillow 52165.0/52500: 99% mana heating_up, firestorm
4:30.440 standard_rotation o pyroblast Fluffy_Pillow 52315.0/52500: 100% mana hot_streak, firestorm
4:31.589 standard_rotation o pyroblast Fluffy_Pillow 52464.0/52500: 100% mana heating_up, firestorm
4:32.739 combustion_phase c fireball Fluffy_Pillow 52500.0/52500: 100% mana hot_streak
4:34.039 combustion_phase W combustion Fluffy_Pillow 52500.0/52500: 100% mana hot_streak
4:34.462 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 46923.0/52500: 89% mana combustion, hot_streak, rune_of_power
4:34.462 combustion_phase Z pyroblast Fluffy_Pillow 46923.0/52500: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:35.613 combustion_phase Z pyroblast Fluffy_Pillow 47074.0/52500: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:35.613 combustion_phase U fire_blast Fluffy_Pillow 46074.0/52500: 88% mana combustion, rune_of_power, gladiators_badge
4:36.763 combustion_phase Z pyroblast Fluffy_Pillow 46724.0/52500: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:36.863 combustion_phase U fire_blast Fluffy_Pillow 45824.0/52500: 87% mana combustion, rune_of_power, gladiators_badge
4:37.914 combustion_phase Z pyroblast Fluffy_Pillow 46375.0/52500: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:39.065 combustion_phase b phoenix_flames Fluffy_Pillow 46526.0/52500: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
4:40.216 combustion_phase Z pyroblast Fluffy_Pillow 47677.0/52500: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:41.368 combustion_phase b phoenix_flames Fluffy_Pillow 47829.0/52500: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
4:42.520 combustion_phase Z pyroblast Fluffy_Pillow 48981.0/52500: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:43.669 combustion_phase d scorch Fluffy_Pillow 49130.0/52500: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
4:44.469 combustion_phase U fire_blast Fluffy_Pillow 49930.0/52500: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
4:44.820 combustion_phase Z pyroblast Fluffy_Pillow 49281.0/52500: 94% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:45.971 combustion_phase Z pyroblast Fluffy_Pillow 49432.0/52500: 94% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:47.120 default O rune_of_power Fluffy_Pillow 49581.0/52500: 94% mana heating_up, firestorm, gladiators_badge
4:48.271 rop_phase f pyroblast Fluffy_Pillow 50732.0/52500: 97% mana heating_up, rune_of_power, firestorm, gladiators_badge
4:49.421 rop_phase f pyroblast Fluffy_Pillow 50882.0/52500: 97% mana hot_streak, rune_of_power, firestorm, gladiators_badge
4:50.571 rop_phase m scorch Fluffy_Pillow 51032.0/52500: 97% mana heating_up, rune_of_power
4:51.721 rop_phase k pyroblast Fluffy_Pillow 51682.0/52500: 98% mana heating_up, rune_of_power
4:52.090 rop_phase h fire_blast Fluffy_Pillow 50993.0/52500: 97% mana rune_of_power
4:52.882 rop_phase m scorch Fluffy_Pillow 51343.0/52500: 98% mana rune_of_power
4:54.033 rop_phase m scorch Fluffy_Pillow 51994.0/52500: 99% mana rune_of_power
4:55.182 rop_phase k pyroblast Fluffy_Pillow 52003.0/52500: 99% mana heating_up, rune_of_power
4:56.344 rop_phase f pyroblast Fluffy_Pillow 52165.0/52500: 99% mana heating_up, rune_of_power, firestorm
4:57.495 rop_phase f pyroblast Fluffy_Pillow 52316.0/52500: 100% mana hot_streak, rune_of_power, firestorm
4:58.645 rop_phase f pyroblast Fluffy_Pillow 52466.0/52500: 100% mana heating_up, rune_of_power, firestorm
4:59.796 rop_phase g pyroblast Fluffy_Pillow 52500.0/52500: 100% mana hot_streak, rune_of_power
4:59.796 rop_phase h fire_blast Fluffy_Pillow 51500.0/52500: 98% mana rune_of_power
5:00.945 standard_rotation v scorch Fluffy_Pillow 52149.0/52500: 99% mana
5:02.095 standard_rotation t phoenix_flames Fluffy_Pillow 52004.0/52500: 99% mana
5:03.245 standard_rotation v scorch Fluffy_Pillow 52500.0/52500: 100% mana
5:04.398 standard_rotation v scorch Fluffy_Pillow 52007.0/52500: 99% mana
5:05.549 standard_rotation s pyroblast Fluffy_Pillow 52005.0/52500: 99% mana heating_up
5:06.709 standard_rotation v scorch Fluffy_Pillow 52165.0/52500: 99% mana
5:07.378 standard_rotation r fire_blast Fluffy_Pillow 52500.0/52500: 100% mana
5:07.862 standard_rotation s pyroblast Fluffy_Pillow 51984.0/52500: 99% mana heating_up
5:09.020 standard_rotation v scorch Fluffy_Pillow 52142.0/52500: 99% mana
5:10.169 standard_rotation v scorch Fluffy_Pillow 52003.0/52500: 99% mana
5:11.322 standard_rotation s pyroblast Fluffy_Pillow 52007.0/52500: 99% mana heating_up
5:12.479 standard_rotation v scorch Fluffy_Pillow 52164.0/52500: 99% mana
5:13.627 standard_rotation v scorch Fluffy_Pillow 52002.0/52500: 99% mana
5:14.778 standard_rotation r fire_blast Fluffy_Pillow 52005.0/52500: 99% mana heating_up
5:15.022 standard_rotation q pyroblast Fluffy_Pillow 51749.0/52500: 99% mana hot_streak, firestorm
5:16.171 standard_rotation o pyroblast Fluffy_Pillow 51898.0/52500: 99% mana heating_up, firestorm
5:17.321 standard_rotation o pyroblast Fluffy_Pillow 52048.0/52500: 99% mana hot_streak, firestorm
5:18.472 default N use_item_dreadfire_vessel Fluffy_Pillow 52199.0/52500: 99% mana heating_up, firestorm
5:18.472 standard_rotation o pyroblast Fluffy_Pillow 52199.0/52500: 99% mana heating_up, firestorm
5:19.625 standard_rotation o pyroblast Fluffy_Pillow 52352.0/52500: 100% mana hot_streak, firestorm

Stats

Level Bonus (60) Race Bonus (gnome) Raid-Buffed Unbuffed Gear Amount
Strength 198 -3 195 195 0
Agility 306 1 307 307 0
Stamina 414 -1 2017 1921 1508
Intellect 450 3 1820 1639 1108 (132)
Spirit 0 0 0 0 0
Health 40340 38420 0
Mana 52500 52500 0
Spell Power 1820 1639 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 30.81% 30.81% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="gnome"
source=default
spec=fire
level=60
race=gnome
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

human : 5089 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5088.5 5088.5 9.7 / 0.190% 780.9 / 15.3% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
801.7 796.9 Mana 0.00% 57.4 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
human 5089
Conflagration Flare Up 24 0.5% 29.9 9.90sec 237 0 Direct 29.9 150 374 237 38.7%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.91 29.91 0.00 0.00 0.0000 0.0000 7088.67 7088.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.28% 18.33 4 33 150.19 130 255 150.19 131 177 2753 2753 0.00%
crit 38.72% 11.58 1 28 374.41 260 510 374.65 268 476 4336 4336 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 10 0.2% 0.7 117.84sec 3901 3371 Direct 0.7 0 3900 3900 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.75 0.75 0.00 0.00 1.1575 0.0000 2919.13 2919.13 0.00% 3370.82 3370.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.75 0 4 3900.10 3792 4404 2181.72 0 4404 2919 2919 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.75
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 160 3.1% 3.3 103.37sec 14486 0 Direct 3.3 11665 23314 14569 24.9%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.31 3.29 0.00 0.00 0.0000 0.0000 47895.06 47895.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.12% 2.47 0 4 11664.75 11358 12040 11553.27 0 12040 28819 28819 0.00%
crit 24.88% 0.82 0 4 23314.37 22716 24079 14187.69 0 24079 19076 19076 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 603 11.9% 42.5 7.12sec 4259 0 Direct 42.5 0 4260 4260 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.49 42.49 0.00 0.00 0.0000 0.0000 180966.66 180966.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.49 33 51 4259.76 3049 5988 4261.65 4016 4552 180967 180967 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.83
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:2.94
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.31
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.41
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 617 (645) 12.1% (12.7%) 77.9 3.40sec 2486 1503 Direct 77.9 (222.0) 1657 3448 2377 40.2% (40.2%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.86 77.85 0.00 0.00 1.6543 0.0000 185091.65 185091.65 0.00% 1503.05 1503.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.80% 46.55 28 67 1657.31 1439 2579 1657.62 1534 1809 77161 77161 0.00%
crit 40.20% 31.30 19 47 3448.17 2878 5651 3451.25 3221 3720 107930 107930 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.70
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.98
    standard_rotation
    [w]:52.23
    Conflagration 28 0.6% 77.9 3.39sec 109 0 Periodic 144.2 36 90 59 43.1% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.85 0.00 144.18 144.18 0.0000 1.4410 8506.17 8506.17 0.00% 40.94 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 56.93% 82.08 56 110 35.56 1 57 35.55 34 38 2919 2919 0.00%
crit 43.07% 62.09 41 88 89.99 0 125 90.08 83 98 5587 5587 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 974 19.1% 265.9 1.13sec 1099 0 Periodic 299.2 977 0 977 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 265.91 0.00 299.20 299.20 0.0000 1.0000 292251.13 292251.13 0.00% 976.78 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 976.85 154 3085 978.20 856 1123 292251 292251 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.40sec 3735 4847

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7707 0.0000 0.00 0.00 0.00% 4846.93 4846.93

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 99  / 37 0.7% 241.1 3.39sec 46 33 Direct 240.4 37 75 46 24.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 241.09 240.36 0.00 0.00 1.3956 0.0000 11177.02 11177.02 0.00% 33.22 33.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.43% 181.30 118 214 37.30 29 53 37.38 35 41 6763 6763 0.00%
crit 24.57% 59.06 31 83 74.74 57 106 74.91 67 87 4414 4414 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:83.40
Phoenix Flames 0 (242) 0.0% (4.8%) 14.1 21.77sec 5142 4690

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.12 0.00 0.00 0.00 1.0964 0.0000 0.00 0.00 0.00% 4690.19 4690.19

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.11
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.35
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.67
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 242 4.8% 14.1 21.73sec 5153 0 Direct 14.1 2101 5986 5155 78.6%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 0.00 0.00 0.0000 0.0000 72622.84 72622.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.43% 3.02 0 7 2100.68 1733 3402 2059.95 0 3402 6346 6346 0.00%
crit 78.57% 11.07 6 16 5986.36 3465 6804 5992.48 5109 6433 66277 66277 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2051 (2182) 40.3% (42.9%) 97.1 3.07sec 6744 6060 Direct 97.7 (276.3) 3090 7742 6294 68.9% (68.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.06 97.74 0.00 0.00 1.1128 0.0000 615105.19 615105.19 0.00% 6060.27 6060.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.13% 30.43 16 45 3089.54 2624 5152 3089.38 2757 3405 93999 93999 0.00%
crit 68.87% 67.31 39 108 7742.25 5248 10305 7766.46 6922 8813 521107 521107 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.21
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.39
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.28
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.74
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.45
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.40
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.90
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.56
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.17
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.95
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 131 2.6% 97.7 3.06sec 403 0 Periodic 178.6 136 349 221 39.6% 86.6%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.74 0.00 178.60 178.60 0.0000 1.4577 39422.63 39422.63 0.00% 151.42 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.40% 107.88 69 149 136.50 7 234 136.51 129 145 14726 14726 0.00%
crit 39.60% 70.72 49 96 349.26 14 469 349.71 325 382 24697 24697 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 212 4.2% 33.8 7.50sec 1887 1643 Direct 33.8 0 1887 1887 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.78 33.78 0.00 0.00 1.1482 0.0000 63728.80 63728.80 0.00% 1643.09 1643.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.78 16 50 1887.06 1152 3345 1887.71 1605 2159 63729 63729 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.75
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:7.98
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.41
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
human
Combustion 4.7 70.60sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.67
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:human
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:human
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.18
Rune of Power 5.3 60.77sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 0.00 0.00 1.1074 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.34
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.6sec 70.6sec 11.8sec 18.42% 0.00% 105.8 (105.8) 4.5

Buff Details

  • buff initial source:human
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:52.4s / 91.1s
  • trigger_min/max:52.4s / 91.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.42%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.7 24.9 9.1sec 4.2sec 5.1sec 36.61% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:human
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 50.1s
  • trigger_min/max:1.3s / 41.7s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 30.6s

Stack Uptimes

  • fireball_1:20.43%
  • fireball_2:9.01%
  • fireball_3:4.45%
  • fireball_4:1.88%
  • fireball_5:0.65%
  • fireball_6:0.17%
  • fireball_7:0.03%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.9 0.8 36.2sec 32.3sec 4.2sec 11.04% 0.00% 0.8 (0.8) 7.7

Buff Details

  • buff initial source:human
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 165.7s
  • trigger_min/max:0.8s / 165.7s
  • trigger_pct:10.18%
  • duration_min/max:0.0s / 14.6s

Stack Uptimes

  • firestorm_1:11.04%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.1sec 72.7sec 14.7sec 22.93% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:human
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 91.1s
  • trigger_min/max:60.0s / 91.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.93%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.5 0.0 3.1sec 3.1sec 1.1sec 35.12% 46.75% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.0s
  • trigger_min/max:0.2s / 19.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.2s

Stack Uptimes

  • heating_up_1:35.12%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.7 0.0 3.5sec 3.5sec 0.6sec 12.97% 86.46% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 35.1s
  • trigger_min/max:0.5s / 35.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.9s

Stack Uptimes

  • hot_streak_1:12.97%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 308.5sec 0.0sec 23.7sec 9.33% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:human
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.33%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.7sec 31.1sec 12.0sec 38.99% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:human
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 71.3s
  • trigger_min/max:2.5s / 71.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s

Stack Uptimes

  • rune_of_power_1:38.99%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:human
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:human
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.5 72.0 122.0 3.1s 0.2s 19.0s
Heating Up removed 11.4 3.0 23.0 23.7s 0.9s 183.2s
Heating Up converted with Fire Blast 23.3 14.0 36.0 12.0s 0.5s 111.2s
Hot Streak procs 84.7 64.0 110.0 3.5s 0.5s 35.1s
Hot Streak spells used 265.9 213.0 319.0 1.1s 0.0s 5.3s
Hot Streak spell crits 185.9 143.0 236.0 1.6s 0.0s 17.8s
Hot Streak spell crits wasted 4.7 0.0 12.0 64.3s 0.1s 317.5s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 13.72% 8.74% 17.56% 0.5s 0.0s 4.6s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3120.00012.6200.9360.00013.498
Rune of Power13.7990.00038.35475.36915.549129.245
Fire Blast0.0940.00018.9194.0231.30034.499
Dragon's Breath143.39646.863348.425287.370196.420359.850
Combustion2.2221.30012.01310.4425.57621.795
Phoenix Flames0.2150.00030.2673.0511.73032.001

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
human
mana_regen Mana 2180.84 239451.76 100.00% 109.80 60710.44 20.23%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 796.86 801.71 60727.7 48543.0 42250.0 50000.0
Usage Type Count Total Avg RPE APR
human
combustion Mana 4.7 23372.8 5000.0 5003.2 0.0
dragons_breath Mana 0.7 1495.7 2000.0 1998.5 2.0
fire_blast Mana 42.5 21244.1 500.0 500.0 8.5
fireball Mana 77.9 77871.9 1000.0 1000.1 2.5
mirror_image Mana 3.0 1992.5 665.8 665.8 5.6
pyroblast Mana 98.1 98062.9 1000.0 1010.4 6.7
scorch Mana 33.8 16878.2 500.0 499.6 3.8

Statistics & Data Analysis

Fight Length
human Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
human Damage Per Second
Count 1717
Mean 5088.54
Minimum 4541.77
Maximum 5723.12
Spread ( max - min ) 1181.35
Range [ ( max - min ) / 2 * 100% ] 11.61%
Standard Deviation 204.3381
5th Percentile 4780.28
95th Percentile 5458.57
( 95th Percentile - 5th Percentile ) 678.29
Mean Distribution
Standard Deviation 4.9313
95.00% Confidence Interval ( 5078.88 - 5098.21 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6195
0.1 Scale Factor Error with Delta=300 357
0.05 Scale Factor Error with Delta=300 1426
0.01 Scale Factor Error with Delta=300 35644
Priority Target DPS
human Priority Target Damage Per Second
Count 1717
Mean 5088.54
Minimum 4541.77
Maximum 5723.12
Spread ( max - min ) 1181.35
Range [ ( max - min ) / 2 * 100% ] 11.61%
Standard Deviation 204.3381
5th Percentile 4780.28
95th Percentile 5458.57
( 95th Percentile - 5th Percentile ) 678.29
Mean Distribution
Standard Deviation 4.9313
95.00% Confidence Interval ( 5078.88 - 5098.21 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6195
0.1 Scale Factor Error with Delta=300 357
0.05 Scale Factor Error with Delta=300 1426
0.01 Scale Factor Error with Delta=300 35644
DPS(e)
human Damage Per Second (Effective)
Count 1717
Mean 5088.54
Minimum 4541.77
Maximum 5723.12
Spread ( max - min ) 1181.35
Range [ ( max - min ) / 2 * 100% ] 11.61%
Damage
human Damage
Count 1717
Mean 1515597.95
Minimum 1160093.39
Maximum 1968053.01
Spread ( max - min ) 807959.62
Range [ ( max - min ) / 2 * 100% ] 26.65%
DTPS
human Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
human Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
human Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
human Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
human Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
human Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
humanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
human Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.34 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.18 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.67 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.83 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.67 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.21 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.39 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.28 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.11 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.70 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.75 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.75 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.74 pyroblast,if=buff.firestorm.react
g 9.45 pyroblast,if=buff.hot_streak.react
h 2.94 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.31 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.40 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.35 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 7.98 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.98 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.90 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.56 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.17 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.41 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.95 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.67 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.41 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 52.23 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUZZUZUZbZYYYYUZbZUOgnnlnNgnnnnhpwrpwwpwwwwwwwwrpwwrpwwwwrpwwrpwwcWUTbZUZbZdUZZdaOlnnnnignigwwwwrpooowpwwrNpwwwrpwwMwwOnhignnnnigcWTbZbZUZdadaeUwpwtwwrpwwwwwwOnignignnnigwwwwwroooowpwrpwwwwwcWUTbZUZbZUZdadaOigmmkmmkhNlmmkvMvrqvqvqvqrqvsvsvrqqvvsvvrqvqvqOhmkmmkmkhmmkfYYcWTZZUZbZbZUZSdavstvrsvvsvrqvqvvO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask human 50000.0/50000: 100% mana
Pre precombat 1 food human 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, heating_up, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.733 combustion_phase Z pyroblast Fluffy_Pillow 43933.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.626 combustion_phase Z pyroblast Fluffy_Pillow 43826.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.626 combustion_phase U fire_blast Fluffy_Pillow 42826.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.516 combustion_phase Z pyroblast Fluffy_Pillow 43216.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.516 combustion_phase U fire_blast Fluffy_Pillow 42216.0/50000: 84% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.408 combustion_phase Z pyroblast Fluffy_Pillow 42608.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.302 combustion_phase b phoenix_flames Fluffy_Pillow 42502.0/50000: 85% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.193 combustion_phase Z pyroblast Fluffy_Pillow 43393.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:07.085 combustion_phase Y pyroblast Fluffy_Pillow 43285.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:07.979 combustion_phase Y pyroblast Fluffy_Pillow 43179.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:08.869 combustion_phase Y pyroblast Fluffy_Pillow 43069.0/50000: 86% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:09.762 combustion_phase Y pyroblast Fluffy_Pillow 42962.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:09.962 combustion_phase U fire_blast Fluffy_Pillow 42162.0/50000: 84% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.653 combustion_phase Z pyroblast Fluffy_Pillow 42353.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.544 combustion_phase b phoenix_flames Fluffy_Pillow 42244.0/50000: 84% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.435 combustion_phase Z pyroblast Fluffy_Pillow 43135.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.135 combustion_phase U fire_blast Fluffy_Pillow 42835.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.326 default O rune_of_power Fluffy_Pillow 42526.0/50000: 85% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:14.218 rop_phase g pyroblast Fluffy_Pillow 43418.0/50000: 87% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.108 rop_phase n fireball Fluffy_Pillow 43308.0/50000: 87% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:16.444 rop_phase n fireball Fluffy_Pillow 43644.0/50000: 87% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.779 rop_phase l phoenix_flames Fluffy_Pillow 43979.0/50000: 88% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:18.670 rop_phase n fireball Fluffy_Pillow 44870.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:20.003 default N use_item_dreadfire_vessel Fluffy_Pillow 45203.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:20.003 rop_phase g pyroblast Fluffy_Pillow 45203.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:20.895 rop_phase n fireball Fluffy_Pillow 45095.0/50000: 90% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:22.228 rop_phase n fireball Fluffy_Pillow 45428.0/50000: 91% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:23.562 rop_phase n fireball Fluffy_Pillow 45762.0/50000: 92% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:24.896 rop_phase n fireball Fluffy_Pillow 46096.0/50000: 92% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:24.996 rop_phase h fire_blast Fluffy_Pillow 46196.0/50000: 92% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:26.231 standard_rotation p pyroblast Fluffy_Pillow 45931.0/50000: 92% mana bloodlust, hot_streak
0:27.122 standard_rotation w fireball Fluffy_Pillow 45822.0/50000: 92% mana bloodlust, heating_up
0:28.022 standard_rotation r fire_blast Fluffy_Pillow 46722.0/50000: 93% mana bloodlust, heating_up
0:28.457 standard_rotation p pyroblast Fluffy_Pillow 45657.0/50000: 91% mana bloodlust, hot_streak
0:29.348 standard_rotation w fireball Fluffy_Pillow 45548.0/50000: 91% mana bloodlust, heating_up
0:30.682 standard_rotation w fireball Fluffy_Pillow 45882.0/50000: 92% mana bloodlust, heating_up
0:32.016 standard_rotation p pyroblast Fluffy_Pillow 46216.0/50000: 92% mana bloodlust, hot_streak
0:32.909 standard_rotation w fireball Fluffy_Pillow 46109.0/50000: 92% mana bloodlust, fireball
0:34.244 standard_rotation w fireball Fluffy_Pillow 46444.0/50000: 93% mana bloodlust, fireball
0:35.579 standard_rotation w fireball Fluffy_Pillow 46779.0/50000: 94% mana bloodlust, fireball(2)
0:36.913 standard_rotation w fireball Fluffy_Pillow 47113.0/50000: 94% mana bloodlust, heating_up
0:38.247 standard_rotation w fireball Fluffy_Pillow 47447.0/50000: 95% mana bloodlust, fireball
0:39.581 standard_rotation w fireball Fluffy_Pillow 47781.0/50000: 96% mana bloodlust, fireball(2)
0:40.916 standard_rotation w fireball Fluffy_Pillow 48116.0/50000: 96% mana bloodlust, fireball(3)
0:42.250 standard_rotation w fireball Fluffy_Pillow 48450.0/50000: 97% mana fireball(4)
0:43.550 standard_rotation r fire_blast Fluffy_Pillow 49750.0/50000: 100% mana heating_up
0:43.984 standard_rotation p pyroblast Fluffy_Pillow 48684.0/50000: 97% mana hot_streak
0:45.141 standard_rotation w fireball Fluffy_Pillow 48841.0/50000: 98% mana fireball
0:46.875 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
0:48.175 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:48.608 standard_rotation p pyroblast Fluffy_Pillow 48933.0/50000: 98% mana hot_streak
0:49.766 standard_rotation w fireball Fluffy_Pillow 49091.0/50000: 98% mana fireball
0:51.498 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
0:53.232 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
0:54.965 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
0:56.265 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:56.699 standard_rotation p pyroblast Fluffy_Pillow 48934.0/50000: 98% mana hot_streak
0:57.858 standard_rotation w fireball Fluffy_Pillow 49093.0/50000: 98% mana fireball
0:59.592 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:00.892 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:01.325 standard_rotation p pyroblast Fluffy_Pillow 48933.0/50000: 98% mana hot_streak
1:02.482 standard_rotation w fireball Fluffy_Pillow 49090.0/50000: 98% mana fireball
1:04.215 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:05.947 combustion_phase c fireball Fluffy_Pillow 49003.0/50000: 98% mana heating_up
1:07.247 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball
1:07.247 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power
1:07.679 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43932.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power
1:07.679 combustion_phase b phoenix_flames Fluffy_Pillow 43932.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, gladiators_badge
1:08.835 combustion_phase Z pyroblast Fluffy_Pillow 45088.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:08.835 combustion_phase U fire_blast Fluffy_Pillow 44088.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
1:09.992 combustion_phase Z pyroblast Fluffy_Pillow 44745.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:11.149 combustion_phase b phoenix_flames Fluffy_Pillow 44902.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
1:12.304 combustion_phase Z pyroblast Fluffy_Pillow 46057.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:13.462 combustion_phase d scorch Fluffy_Pillow 46215.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.362 combustion_phase U fire_blast Fluffy_Pillow 47115.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.620 combustion_phase Z pyroblast Fluffy_Pillow 46373.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:15.777 combustion_phase Z pyroblast Fluffy_Pillow 46530.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:16.935 combustion_phase d scorch Fluffy_Pillow 46688.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:18.092 combustion_phase a pyroblast Fluffy_Pillow 47345.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
1:19.259 default O rune_of_power Fluffy_Pillow 47512.0/50000: 95% mana heating_up, gladiators_badge
1:20.417 rop_phase l phoenix_flames Fluffy_Pillow 48670.0/50000: 97% mana heating_up, rune_of_power, gladiators_badge
1:21.574 rop_phase n fireball Fluffy_Pillow 49827.0/50000: 100% mana rune_of_power, gladiators_badge
1:23.306 rop_phase n fireball Fluffy_Pillow 49003.0/50000: 98% mana rune_of_power
1:25.040 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
1:26.773 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power
1:28.173 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
1:28.508 rop_phase g pyroblast Fluffy_Pillow 48835.0/50000: 98% mana hot_streak, rune_of_power
1:29.665 rop_phase n fireball Fluffy_Pillow 48992.0/50000: 98% mana fireball, heating_up, rune_of_power
1:30.965 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up, rune_of_power
1:31.398 rop_phase g pyroblast Fluffy_Pillow 48933.0/50000: 98% mana fireball, hot_streak, rune_of_power
1:32.554 standard_rotation w fireball Fluffy_Pillow 49089.0/50000: 98% mana fireball(2)
1:34.288 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:36.022 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
1:37.755 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:39.255 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:39.490 standard_rotation p pyroblast Fluffy_Pillow 48735.0/50000: 97% mana hot_streak, firestorm
1:40.649 standard_rotation o pyroblast Fluffy_Pillow 48894.0/50000: 98% mana fireball, heating_up, firestorm
1:41.805 standard_rotation o pyroblast Fluffy_Pillow 49050.0/50000: 98% mana fireball, hot_streak, firestorm
1:42.964 standard_rotation o pyroblast Fluffy_Pillow 49209.0/50000: 98% mana fireball, heating_up, firestorm
1:44.121 standard_rotation w fireball Fluffy_Pillow 49366.0/50000: 99% mana fireball, hot_streak
1:45.854 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
1:47.012 standard_rotation w fireball Fluffy_Pillow 49162.0/50000: 98% mana fireball(2)
1:48.745 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:50.345 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:50.478 default N use_item_dreadfire_vessel Fluffy_Pillow 48633.0/50000: 97% mana hot_streak
1:50.478 standard_rotation p pyroblast Fluffy_Pillow 48633.0/50000: 97% mana hot_streak
1:51.635 standard_rotation w fireball Fluffy_Pillow 48790.0/50000: 98% mana fireball
1:53.369 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:55.104 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
1:56.404 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:56.836 standard_rotation p pyroblast Fluffy_Pillow 48932.0/50000: 98% mana hot_streak
1:57.992 standard_rotation w fireball Fluffy_Pillow 49088.0/50000: 98% mana heating_up
1:59.726 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:01.459 default M mirror_image Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:02.616 standard_rotation w fireball Fluffy_Pillow 49161.0/50000: 98% mana fireball(2)
2:04.349 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:06.082 default O rune_of_power Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
2:07.239 rop_phase n fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball(4), rune_of_power
2:08.139 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(4), rune_of_power
2:08.639 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(4), heating_up, rune_of_power
2:08.972 rop_phase g pyroblast Fluffy_Pillow 48833.0/50000: 98% mana fireball(4), hot_streak, rune_of_power
2:10.130 rop_phase n fireball Fluffy_Pillow 48991.0/50000: 98% mana heating_up, rune_of_power
2:11.865 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up, rune_of_power
2:13.596 rop_phase n fireball Fluffy_Pillow 49002.0/50000: 98% mana fireball, rune_of_power
2:15.329 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power
2:16.629 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
2:17.064 rop_phase g pyroblast Fluffy_Pillow 48935.0/50000: 98% mana hot_streak, rune_of_power
2:18.221 combustion_phase c fireball Fluffy_Pillow 49092.0/50000: 98% mana fireball, rune_of_power
2:19.521 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball
2:19.955 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44434.0/50000: 89% mana combustion, fireball, rune_of_power
2:19.955 combustion_phase b phoenix_flames Fluffy_Pillow 44434.0/50000: 89% mana combustion, fireball, rune_of_power, gladiators_badge
2:21.115 combustion_phase Z pyroblast Fluffy_Pillow 45594.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:22.274 combustion_phase b phoenix_flames Fluffy_Pillow 45753.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:23.430 combustion_phase Z pyroblast Fluffy_Pillow 46909.0/50000: 94% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.530 combustion_phase U fire_blast Fluffy_Pillow 46009.0/50000: 92% mana combustion, rune_of_power, gladiators_badge
2:24.586 combustion_phase Z pyroblast Fluffy_Pillow 46565.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:25.743 combustion_phase d scorch Fluffy_Pillow 46722.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:26.901 combustion_phase a pyroblast Fluffy_Pillow 47380.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
2:28.069 combustion_phase d scorch Fluffy_Pillow 47548.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
2:29.229 combustion_phase a pyroblast Fluffy_Pillow 48208.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
2:30.394 combustion_phase e dragons_breath Fluffy_Pillow 48373.0/50000: 97% mana combustion, heating_up, rune_of_power, gladiators_badge
2:31.194 combustion_phase U fire_blast Fluffy_Pillow 47173.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
2:31.550 standard_rotation w fireball Fluffy_Pillow 47029.0/50000: 94% mana hot_streak, gladiators_badge
2:33.284 standard_rotation p pyroblast Fluffy_Pillow 47763.0/50000: 96% mana hot_streak, gladiators_badge
2:34.444 standard_rotation w fireball Fluffy_Pillow 47923.0/50000: 96% mana fireball, heating_up, gladiators_badge
2:36.178 standard_rotation t phoenix_flames Fluffy_Pillow 48657.0/50000: 97% mana fireball, heating_up
2:37.337 standard_rotation w fireball Fluffy_Pillow 49816.0/50000: 100% mana fireball(2)
2:39.070 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:40.670 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:40.805 standard_rotation p pyroblast Fluffy_Pillow 48635.0/50000: 97% mana hot_streak
2:41.964 standard_rotation w fireball Fluffy_Pillow 48794.0/50000: 98% mana fireball
2:43.697 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:45.431 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:47.164 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:48.897 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:50.631 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
2:52.365 default O rune_of_power Fluffy_Pillow 49005.0/50000: 98% mana fireball(4)
2:53.522 rop_phase n fireball Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
2:54.822 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
2:55.254 rop_phase g pyroblast Fluffy_Pillow 48932.0/50000: 98% mana hot_streak, rune_of_power
2:56.411 rop_phase n fireball Fluffy_Pillow 49089.0/50000: 98% mana fireball, heating_up, rune_of_power
2:57.711 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up, rune_of_power
2:58.146 rop_phase g pyroblast Fluffy_Pillow 48935.0/50000: 98% mana fireball, hot_streak, rune_of_power
2:59.304 rop_phase n fireball Fluffy_Pillow 49093.0/50000: 98% mana heating_up, rune_of_power
3:01.037 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, rune_of_power
3:02.772 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, rune_of_power
3:04.072 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
3:04.506 rop_phase g pyroblast Fluffy_Pillow 48934.0/50000: 98% mana hot_streak, rune_of_power
3:05.663 standard_rotation w fireball Fluffy_Pillow 49091.0/50000: 98% mana fireball, heating_up
3:07.395 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball, heating_up
3:09.128 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:10.862 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
3:12.595 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
3:13.895 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:14.328 standard_rotation o pyroblast Fluffy_Pillow 48933.0/50000: 98% mana hot_streak, firestorm
3:15.485 standard_rotation o pyroblast Fluffy_Pillow 49090.0/50000: 98% mana fireball, heating_up, firestorm
3:16.643 standard_rotation o pyroblast Fluffy_Pillow 49248.0/50000: 98% mana fireball, hot_streak, firestorm
3:17.799 standard_rotation o pyroblast Fluffy_Pillow 49404.0/50000: 99% mana fireball, heating_up, firestorm
3:18.956 standard_rotation w fireball Fluffy_Pillow 49561.0/50000: 99% mana fireball, hot_streak
3:20.689 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
3:21.846 standard_rotation w fireball Fluffy_Pillow 49161.0/50000: 98% mana heating_up
3:23.146 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:23.579 standard_rotation p pyroblast Fluffy_Pillow 48933.0/50000: 98% mana hot_streak
3:24.736 standard_rotation w fireball Fluffy_Pillow 49090.0/50000: 98% mana fireball
3:26.471 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
3:28.205 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
3:29.939 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:31.672 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:33.407 combustion_phase c fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up
3:34.707 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball
3:34.707 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power
3:35.139 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43932.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power
3:35.139 combustion_phase b phoenix_flames Fluffy_Pillow 43932.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, gladiators_badge
3:36.297 combustion_phase Z pyroblast Fluffy_Pillow 45090.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:36.297 combustion_phase U fire_blast Fluffy_Pillow 44090.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
3:37.455 combustion_phase Z pyroblast Fluffy_Pillow 44748.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:38.612 combustion_phase b phoenix_flames Fluffy_Pillow 44905.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:39.771 combustion_phase Z pyroblast Fluffy_Pillow 46064.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:40.371 combustion_phase U fire_blast Fluffy_Pillow 45664.0/50000: 91% mana combustion, rune_of_power, gladiators_badge
3:40.927 combustion_phase Z pyroblast Fluffy_Pillow 45720.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:42.085 combustion_phase d scorch Fluffy_Pillow 45878.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:43.243 combustion_phase a pyroblast Fluffy_Pillow 46536.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
3:44.410 combustion_phase d scorch Fluffy_Pillow 46703.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
3:45.568 combustion_phase a pyroblast Fluffy_Pillow 47361.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
3:46.737 default O rune_of_power Fluffy_Pillow 47530.0/50000: 95% mana heating_up, gladiators_badge
3:47.894 rop_phase i fire_blast Fluffy_Pillow 48687.0/50000: 97% mana heating_up, rune_of_power, gladiators_badge
3:48.039 rop_phase g pyroblast Fluffy_Pillow 48332.0/50000: 97% mana hot_streak, rune_of_power, gladiators_badge
3:49.195 rop_phase m scorch Fluffy_Pillow 48488.0/50000: 97% mana rune_of_power, gladiators_badge
3:50.353 rop_phase m scorch Fluffy_Pillow 49146.0/50000: 98% mana rune_of_power
3:51.512 rop_phase k pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
3:52.679 rop_phase m scorch Fluffy_Pillow 49673.0/50000: 99% mana rune_of_power
3:53.835 rop_phase m scorch Fluffy_Pillow 49503.0/50000: 99% mana rune_of_power
3:54.992 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
3:55.726 rop_phase h fire_blast Fluffy_Pillow 49215.0/50000: 98% mana rune_of_power
3:56.159 default N use_item_dreadfire_vessel Fluffy_Pillow 49171.0/50000: 98% mana heating_up, rune_of_power
3:56.159 rop_phase l phoenix_flames Fluffy_Pillow 49171.0/50000: 98% mana heating_up, rune_of_power
3:57.317 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
3:58.476 rop_phase m scorch Fluffy_Pillow 49506.0/50000: 99% mana rune_of_power
3:59.633 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:00.801 standard_rotation v scorch Fluffy_Pillow 49672.0/50000: 99% mana
4:01.958 default M mirror_image Fluffy_Pillow 49504.0/50000: 99% mana
4:03.115 standard_rotation v scorch Fluffy_Pillow 49661.0/50000: 99% mana heating_up
4:04.272 standard_rotation r fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:04.272 standard_rotation q pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
4:05.429 standard_rotation v scorch Fluffy_Pillow 49161.0/50000: 98% mana hot_streak
4:06.584 standard_rotation q pyroblast Fluffy_Pillow 49502.0/50000: 99% mana hot_streak
4:07.741 standard_rotation v scorch Fluffy_Pillow 49659.0/50000: 99% mana hot_streak
4:08.898 standard_rotation q pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak
4:10.054 standard_rotation v scorch Fluffy_Pillow 49660.0/50000: 99% mana hot_streak
4:11.211 standard_rotation q pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak
4:11.311 standard_rotation r fire_blast Fluffy_Pillow 48604.0/50000: 97% mana heating_up
4:12.367 standard_rotation q pyroblast Fluffy_Pillow 49160.0/50000: 98% mana hot_streak
4:13.526 standard_rotation v scorch Fluffy_Pillow 49319.0/50000: 99% mana heating_up
4:14.683 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:15.850 standard_rotation v scorch Fluffy_Pillow 49671.0/50000: 99% mana heating_up
4:17.008 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:18.175 standard_rotation v scorch Fluffy_Pillow 49672.0/50000: 99% mana heating_up
4:19.331 standard_rotation r fire_blast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:19.331 standard_rotation q pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak
4:20.488 standard_rotation q pyroblast Fluffy_Pillow 49160.0/50000: 98% mana hot_streak
4:21.646 standard_rotation v scorch Fluffy_Pillow 49318.0/50000: 99% mana
4:22.804 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:23.963 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:25.127 standard_rotation v scorch Fluffy_Pillow 49670.0/50000: 99% mana
4:26.284 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:27.442 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:27.442 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
4:28.599 standard_rotation v scorch Fluffy_Pillow 49162.0/50000: 98% mana hot_streak
4:29.758 standard_rotation q pyroblast Fluffy_Pillow 49506.0/50000: 99% mana hot_streak
4:30.916 standard_rotation v scorch Fluffy_Pillow 49664.0/50000: 99% mana hot_streak
4:32.074 standard_rotation q pyroblast Fluffy_Pillow 49505.0/50000: 99% mana hot_streak
4:33.232 default O rune_of_power Fluffy_Pillow 49663.0/50000: 99% mana
4:34.389 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
4:34.389 rop_phase m scorch Fluffy_Pillow 49500.0/50000: 99% mana heating_up, rune_of_power
4:35.546 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:36.714 rop_phase m scorch Fluffy_Pillow 49672.0/50000: 99% mana rune_of_power
4:37.871 rop_phase m scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
4:39.028 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:40.198 rop_phase m scorch Fluffy_Pillow 49674.0/50000: 99% mana heating_up, rune_of_power
4:41.354 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
4:41.848 rop_phase h fire_blast Fluffy_Pillow 48915.0/50000: 98% mana rune_of_power
4:42.523 rop_phase m scorch Fluffy_Pillow 49172.0/50000: 98% mana rune_of_power
4:43.680 rop_phase m scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
4:44.837 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:46.006 rop_phase f pyroblast Fluffy_Pillow 49673.0/50000: 99% mana heating_up, rune_of_power, firestorm
4:47.164 combustion_phase Y pyroblast Fluffy_Pillow 49831.0/50000: 100% mana hot_streak, firestorm
4:48.321 combustion_phase Y pyroblast Fluffy_Pillow 49988.0/50000: 100% mana heating_up, firestorm
4:49.478 combustion_phase c fireball Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:50.778 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:51.212 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44434.0/50000: 89% mana combustion, hot_streak, rune_of_power
4:51.212 combustion_phase Z pyroblast Fluffy_Pillow 44434.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:52.371 combustion_phase Z pyroblast Fluffy_Pillow 44593.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:52.371 combustion_phase U fire_blast Fluffy_Pillow 43593.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
4:53.528 combustion_phase Z pyroblast Fluffy_Pillow 44250.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:54.686 combustion_phase b phoenix_flames Fluffy_Pillow 44408.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.845 combustion_phase Z pyroblast Fluffy_Pillow 45567.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:57.002 combustion_phase b phoenix_flames Fluffy_Pillow 45724.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
4:58.160 combustion_phase Z pyroblast Fluffy_Pillow 46882.0/50000: 94% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:58.160 combustion_phase U fire_blast Fluffy_Pillow 45882.0/50000: 92% mana combustion, rune_of_power, gladiators_badge
4:59.318 combustion_phase Z pyroblast Fluffy_Pillow 46540.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
5:00.476 combustion_cooldowns S potion Fluffy_Pillow 46698.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
5:00.476 combustion_phase d scorch Fluffy_Pillow 46698.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:01.633 combustion_phase a pyroblast Fluffy_Pillow 47355.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:02.802 standard_rotation v scorch Fluffy_Pillow 47524.0/50000: 95% mana heating_up, gladiators_badge, potion_of_spectral_intellect
5:03.959 standard_rotation s pyroblast Fluffy_Pillow 48181.0/50000: 96% mana heating_up, gladiators_badge, potion_of_spectral_intellect
5:05.127 standard_rotation t phoenix_flames Fluffy_Pillow 48349.0/50000: 97% mana gladiators_badge, potion_of_spectral_intellect
5:06.460 standard_rotation v scorch Fluffy_Pillow 49682.0/50000: 99% mana potion_of_spectral_intellect
5:06.460 standard_rotation r fire_blast Fluffy_Pillow 49682.0/50000: 99% mana potion_of_spectral_intellect
5:07.618 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, potion_of_spectral_intellect
5:08.784 standard_rotation v scorch Fluffy_Pillow 49671.0/50000: 99% mana potion_of_spectral_intellect
5:09.942 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana potion_of_spectral_intellect
5:11.099 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, potion_of_spectral_intellect
5:12.267 standard_rotation v scorch Fluffy_Pillow 49672.0/50000: 99% mana heating_up, potion_of_spectral_intellect
5:13.424 standard_rotation r fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, potion_of_spectral_intellect
5:13.424 standard_rotation q pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, potion_of_spectral_intellect
5:14.579 standard_rotation v scorch Fluffy_Pillow 49159.0/50000: 98% mana hot_streak, potion_of_spectral_intellect
5:15.737 standard_rotation q pyroblast Fluffy_Pillow 49505.0/50000: 99% mana hot_streak, potion_of_spectral_intellect
5:16.895 standard_rotation v scorch Fluffy_Pillow 49663.0/50000: 99% mana potion_of_spectral_intellect
5:18.052 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana potion_of_spectral_intellect
5:19.209 default O rune_of_power Fluffy_Pillow 49504.0/50000: 99% mana heating_up, potion_of_spectral_intellect

Stats

Level Bonus (60) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 0 306 306 0
Stamina 414 0 2018 1922 1508
Intellect 450 0 1816 1635 1108 (132)
Spirit 0 0 0 0 0
Health 40360 38440 0
Mana 50000 50000 0
Spell Power 1816 1635 0
Melee Crit 9.54% 9.54% 159
Spell Crit 24.54% 24.54% 159
Haste 30.08% 30.08% 993
Versatility 7.40% 7.40% 296
Mana Regen 1000 1000 0
Mastery 17.49% 17.49% 536
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="human"
source=default
spec=fire
level=60
race=human
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

kul_tiran : 5091 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5090.9 5090.9 9.7 / 0.190% 797.3 / 15.7% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
798.0 793.4 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
kul_tiran 5091
Conflagration Flare Up 24 0.5% 29.7 9.84sec 239 0 Direct 29.7 151 377 239 38.7%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.66 29.66 0.00 0.00 0.0000 0.0000 7078.34 7078.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.26% 18.17 5 34 151.07 131 257 151.11 134 175 2745 2745 0.00%
crit 38.74% 11.49 2 28 377.20 262 514 377.47 271 474 4333 4333 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.8 113.95sec 3929 3382 Direct 0.8 0 3929 3929 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.81 0.81 0.00 0.00 1.1625 0.0000 3199.14 3199.14 0.00% 3381.75 3381.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.81 0 4 3928.77 3820 4437 2339.88 0 4437 3199 3199 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.81
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 159 3.1% 3.3 103.67sec 14487 0 Direct 3.3 11757 23522 14533 23.7%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.29 0.00 0.00 0.0000 0.0000 47797.00 47797.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.32% 2.51 0 4 11756.93 11448 12135 11582.00 0 12135 29494 29494 0.00%
crit 23.68% 0.78 0 3 23522.20 22896 24270 13733.57 0 24270 18303 18303 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 605 11.9% 42.3 7.15sec 4290 0 Direct 42.3 0 4290 4290 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.29 42.29 0.00 0.00 0.0000 0.0000 181428.72 181428.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.29 33 50 4290.25 3072 6033 4291.90 4094 4550 181429 181429 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.68
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:3.09
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.29
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.24
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 617 (646) 12.1% (12.7%) 77.4 3.39sec 2503 1505 Direct 77.4 (220.9) 1670 3476 2393 40.1% (40.1%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.42 77.41 0.00 0.00 1.6627 0.0000 185270.61 185270.61 0.00% 1505.44 1505.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.94% 46.40 27 73 1669.87 1450 2598 1670.43 1545 1811 77487 77487 0.00%
crit 40.06% 31.01 18 45 3475.53 2899 5694 3478.78 3256 3829 107783 107783 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.68
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.89
    standard_rotation
    [w]:51.88
    Conflagration 28 0.6% 77.4 3.38sec 110 0 Periodic 143.4 36 91 59 42.9% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.41 0.00 143.44 143.44 0.0000 1.4470 8518.94 8518.94 0.00% 41.04 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.13% 81.95 57 110 35.85 0 57 35.84 34 38 2938 2938 0.00%
crit 42.87% 61.50 42 84 90.76 0 126 90.85 83 98 5581 5581 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 963 18.9% 264.6 1.14sec 1092 0 Periodic 299.2 966 0 966 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.62 0.00 299.20 299.20 0.0000 1.0000 289089.85 289089.85 0.00% 966.21 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 966.24 153 2939 967.31 828 1138 289090 289090 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.44sec 3686 4762

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7740 0.0000 0.00 0.00 0.00% 4762.07 4762.07

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 33 Direct 235.3 38 75 47 24.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.00 235.27 0.00 0.00 1.3988 0.0000 11028.96 11028.96 0.00% 33.41 33.41
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.49% 177.61 117 209 37.65 29 53 37.73 35 41 6687 6687 0.00%
crit 24.51% 57.67 30 92 75.30 58 107 75.48 67 87 4342 4342 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.70
Phoenix Flames 0 (244) 0.0% (4.8%) 14.1 21.64sec 5187 4712

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.11 0.00 0.00 0.00 1.1010 0.0000 0.00 0.00 0.00% 4711.74 4711.74

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.10
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.31
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.70
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 244 4.8% 14.1 21.66sec 5196 0 Direct 14.1 2109 6035 5198 78.6%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 0.00 0.00 0.0000 0.0000 73201.54 73201.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.38% 3.01 0 8 2109.17 1745 3428 2073.58 0 3234 6351 6351 0.00%
crit 78.62% 11.08 6 16 6035.44 3491 6855 6041.59 5006 6436 66851 66851 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2058 (2190) 40.4% (43.0%) 96.5 3.12sec 6813 6096 Direct 97.2 (275.0) 3112 7823 6358 68.9% (68.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.46 97.15 0.00 0.00 1.1176 0.0000 617639.99 617639.99 0.00% 6095.95 6095.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.11% 30.23 16 45 3112.23 2643 5191 3111.82 2790 3378 94073 94073 0.00%
crit 68.89% 66.93 40 105 7822.76 5286 10382 7848.77 7068 8729 523567 523567 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.10
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.27
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.27
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.99
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.47
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.44
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.53
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.37
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.19
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.83
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.6% 97.2 3.12sec 406 0 Periodic 177.8 137 352 222 39.5% 86.5%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.15 0.00 177.83 177.83 0.0000 1.4622 39484.65 39484.65 0.00% 151.86 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.51% 107.61 69 149 137.36 5 236 137.37 130 145 14781 14781 0.00%
crit 39.49% 70.22 46 102 351.81 10 472 352.34 325 386 24704 24704 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 213 4.2% 33.7 7.18sec 1903 1651 Direct 33.7 0 1904 1904 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.70 33.70 0.00 0.00 1.1530 0.0000 64137.94 64137.94 0.00% 1650.66 1650.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.70 17 52 1903.76 1019 3371 1904.69 1721 2229 64138 64138 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.73
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:8.06
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.28
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
kul_tiran
Combustion 4.7 70.98sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.66
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:kul_tiran
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:kul_tiran
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.18
Rune of Power 5.3 59.22sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 1.1122 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.36
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.7sec 70.7sec 11.8sec 18.39% 0.00% 105.7 (105.7) 4.5

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:49.7s / 89.2s
  • trigger_min/max:49.7s / 89.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • combustion_1:18.39%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.6 24.8 9.1sec 4.2sec 5.1sec 36.75% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 49.7s
  • trigger_min/max:1.3s / 47.1s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 31.9s

Stack Uptimes

  • fireball_1:20.56%
  • fireball_2:9.03%
  • fireball_3:4.40%
  • fireball_4:1.92%
  • fireball_5:0.64%
  • fireball_6:0.18%
  • fireball_7:0.03%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.8 36.6sec 32.5sec 4.2sec 10.90% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 154.5s
  • trigger_min/max:0.8s / 151.8s
  • trigger_pct:10.13%
  • duration_min/max:0.0s / 15.9s

Stack Uptimes

  • firestorm_1:10.90%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.6 0.0 71.2sec 72.8sec 14.8sec 22.90% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 89.4s
  • trigger_min/max:60.0s / 89.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.90%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.2 0.0 3.1sec 3.1sec 1.1sec 35.14% 46.70% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.2s
  • trigger_min/max:0.2s / 19.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • heating_up_1:35.14%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.3 0.0 3.6sec 3.6sec 0.6sec 13.03% 86.52% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 30.2s
  • trigger_min/max:0.5s / 30.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.4s

Stack Uptimes

  • hot_streak_1:13.03%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 307.2sec 0.0sec 23.8sec 9.37% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 358.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.37%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.7sec 31.0sec 12.0sec 39.05% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 73.5s
  • trigger_min/max:3.6s / 73.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s

Stack Uptimes

  • rune_of_power_1:39.05%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.2 72.0 124.0 3.1s 0.2s 19.2s
Heating Up removed 11.5 3.0 22.0 23.6s 0.7s 193.3s
Heating Up converted with Fire Blast 23.3 14.0 34.0 12.1s 0.5s 99.1s
Hot Streak procs 84.3 62.0 111.0 3.6s 0.5s 30.2s
Hot Streak spells used 264.6 213.0 318.0 1.1s 0.0s 5.2s
Hot Streak spell crits 185.0 139.0 238.0 1.6s 0.0s 18.5s
Hot Streak spell crits wasted 4.6 0.0 11.0 64.6s 0.1s 319.0s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.07% 8.54% 19.40% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3210.00012.8980.9630.00024.927
Rune of Power13.6230.00039.97974.72519.096128.967
Fire Blast0.0960.00021.8154.0701.30029.118
Dragon's Breath139.70641.998310.077286.205205.003359.850
Combustion2.2091.30013.48210.3455.43222.799
Phoenix Flames0.2120.00027.2182.9921.73827.218

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
kul_tiran
mana_regen Mana 2174.38 238404.56 100.00% 109.64 61746.12 20.57%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.37 797.98 61763.2 48614.8 42267.0 50000.0
Usage Type Count Total Avg RPE APR
kul_tiran
combustion Mana 4.7 23297.7 5000.0 5002.8 0.0
dragons_breath Mana 0.8 1628.4 2000.0 2000.0 2.0
fire_blast Mana 42.3 21145.4 500.0 500.0 8.6
fireball Mana 77.4 77426.4 1000.0 1000.1 2.5
mirror_image Mana 3.0 1992.5 665.8 665.8 5.5
pyroblast Mana 97.5 97470.3 1000.0 1010.5 6.7
scorch Mana 33.7 16837.9 500.0 499.6 3.8

Statistics & Data Analysis

Fight Length
kul_tiran Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
kul_tiran Damage Per Second
Count 1717
Mean 5090.92
Minimum 4470.83
Maximum 5799.70
Spread ( max - min ) 1328.87
Range [ ( max - min ) / 2 * 100% ] 13.05%
Standard Deviation 204.1454
5th Percentile 4777.16
95th Percentile 5442.80
( 95th Percentile - 5th Percentile ) 665.64
Mean Distribution
Standard Deviation 4.9267
95.00% Confidence Interval ( 5081.26 - 5100.57 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6178
0.1 Scale Factor Error with Delta=300 356
0.05 Scale Factor Error with Delta=300 1424
0.01 Scale Factor Error with Delta=300 35577
Priority Target DPS
kul_tiran Priority Target Damage Per Second
Count 1717
Mean 5090.92
Minimum 4470.83
Maximum 5799.70
Spread ( max - min ) 1328.87
Range [ ( max - min ) / 2 * 100% ] 13.05%
Standard Deviation 204.1454
5th Percentile 4777.16
95th Percentile 5442.80
( 95th Percentile - 5th Percentile ) 665.64
Mean Distribution
Standard Deviation 4.9267
95.00% Confidence Interval ( 5081.26 - 5100.57 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6178
0.1 Scale Factor Error with Delta=300 356
0.05 Scale Factor Error with Delta=300 1424
0.01 Scale Factor Error with Delta=300 35577
DPS(e)
kul_tiran Damage Per Second (Effective)
Count 1717
Mean 5090.92
Minimum 4470.83
Maximum 5799.70
Spread ( max - min ) 1328.87
Range [ ( max - min ) / 2 * 100% ] 13.05%
Damage
kul_tiran Damage
Count 1717
Mean 1516846.71
Minimum 1170346.27
Maximum 1962999.61
Spread ( max - min ) 792653.34
Range [ ( max - min ) / 2 * 100% ] 26.13%
DTPS
kul_tiran Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
kul_tiran Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
kul_tiran Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
kul_tiran Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
kul_tiran Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
kul_tiran Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
kul_tiranTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
kul_tiran Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.36 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.18 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.65 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.68 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.66 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.10 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.27 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.27 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.10 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.68 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.73 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.81 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.99 pyroblast,if=buff.firestorm.react
g 9.47 pyroblast,if=buff.hot_streak.react
h 3.09 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.29 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.44 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.31 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 8.06 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.89 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.53 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.37 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.19 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.24 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.83 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.70 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.28 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.88 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUYYYYZUZUZbZbZOfffgnigNnnnnhnpwooooooooooowrpwpwrpwpwwcWZZUZUZUZTbZbZUZOnngnnignlwpwrpwwrpwwwrpwwwwwwrpwwwrpwwwMwpwcWUTbZUZbZUZdadaOfffffgnhNnntwpwrpwpwwwwwwrpwwwwwwwOhnignignnnicWTZZbZUZbZdaUZwwwwwwrpwpqrooovsOhmkmkNmMghmmkmsvrsvvsvvsvrsvsoooqvcWUTZZYYYZUYYYUZOlmmkmhkmmkmmrqqttvvsvrsvootvrsvvsvvrq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask kul_tiran 50000.0/50000: 100% mana
Pre precombat 1 food kul_tiran 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.741 combustion_phase b phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.635 combustion_phase Z pyroblast Fluffy_Pillow 44835.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:02.635 combustion_phase U fire_blast Fluffy_Pillow 43835.0/50000: 88% mana bloodlust, combustion, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:03.529 combustion_phase Y pyroblast Fluffy_Pillow 44229.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:04.425 combustion_phase Y pyroblast Fluffy_Pillow 44125.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:05.321 combustion_phase Y pyroblast Fluffy_Pillow 44021.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:06.215 combustion_phase Y pyroblast Fluffy_Pillow 43915.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:07.109 combustion_phase Z pyroblast Fluffy_Pillow 43809.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.109 combustion_phase U fire_blast Fluffy_Pillow 42809.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.003 combustion_phase Z pyroblast Fluffy_Pillow 43203.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.003 combustion_phase U fire_blast Fluffy_Pillow 42203.0/50000: 84% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.898 combustion_phase Z pyroblast Fluffy_Pillow 42598.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.794 combustion_phase b phoenix_flames Fluffy_Pillow 42494.0/50000: 85% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.689 combustion_phase Z pyroblast Fluffy_Pillow 43389.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.584 combustion_phase b phoenix_flames Fluffy_Pillow 43284.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.478 combustion_phase Z pyroblast Fluffy_Pillow 44178.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:13.372 default O rune_of_power Fluffy_Pillow 44072.0/50000: 88% mana bloodlust, heating_up, firestorm, gladiators_badge, potion_of_spectral_intellect
0:14.268 rop_phase f pyroblast Fluffy_Pillow 44968.0/50000: 90% mana bloodlust, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:15.164 rop_phase f pyroblast Fluffy_Pillow 44864.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, firestorm, potion_of_spectral_intellect
0:16.059 rop_phase f pyroblast Fluffy_Pillow 44759.0/50000: 90% mana bloodlust, heating_up, rune_of_power, firestorm, potion_of_spectral_intellect
0:16.952 rop_phase g pyroblast Fluffy_Pillow 44652.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:17.846 rop_phase n fireball Fluffy_Pillow 44546.0/50000: 89% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:18.746 rop_phase i fire_blast Fluffy_Pillow 45446.0/50000: 91% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:19.186 rop_phase g pyroblast Fluffy_Pillow 44386.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:20.081 default N use_item_dreadfire_vessel Fluffy_Pillow 44281.0/50000: 89% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:20.081 rop_phase n fireball Fluffy_Pillow 44281.0/50000: 89% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:21.421 rop_phase n fireball Fluffy_Pillow 44621.0/50000: 89% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:22.760 rop_phase n fireball Fluffy_Pillow 44960.0/50000: 90% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:24.100 rop_phase n fireball Fluffy_Pillow 45300.0/50000: 91% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:25.100 rop_phase h fire_blast Fluffy_Pillow 46300.0/50000: 93% mana bloodlust, heating_up, rune_of_power
0:25.440 rop_phase n fireball Fluffy_Pillow 45140.0/50000: 90% mana bloodlust, hot_streak, rune_of_power
0:26.781 standard_rotation p pyroblast Fluffy_Pillow 45481.0/50000: 91% mana bloodlust, fireball, hot_streak
0:27.674 standard_rotation w fireball Fluffy_Pillow 45374.0/50000: 91% mana bloodlust, hot_streak, firestorm
0:29.015 standard_rotation o pyroblast Fluffy_Pillow 45715.0/50000: 91% mana bloodlust, hot_streak, firestorm
0:29.910 standard_rotation o pyroblast Fluffy_Pillow 45610.0/50000: 91% mana bloodlust, fireball, heating_up, firestorm
0:30.804 standard_rotation o pyroblast Fluffy_Pillow 45504.0/50000: 91% mana bloodlust, fireball, hot_streak, firestorm
0:31.699 standard_rotation o pyroblast Fluffy_Pillow 45399.0/50000: 91% mana bloodlust, fireball, heating_up, firestorm
0:32.593 standard_rotation o pyroblast Fluffy_Pillow 45293.0/50000: 91% mana bloodlust, fireball, hot_streak, firestorm
0:33.487 standard_rotation o pyroblast Fluffy_Pillow 45187.0/50000: 90% mana bloodlust, fireball, heating_up, firestorm
0:34.381 standard_rotation o pyroblast Fluffy_Pillow 45081.0/50000: 90% mana bloodlust, fireball, hot_streak, firestorm
0:35.274 standard_rotation o pyroblast Fluffy_Pillow 44974.0/50000: 90% mana bloodlust, fireball, heating_up, firestorm
0:36.170 standard_rotation o pyroblast Fluffy_Pillow 44870.0/50000: 90% mana bloodlust, fireball, hot_streak, firestorm
0:37.065 standard_rotation o pyroblast Fluffy_Pillow 44765.0/50000: 90% mana bloodlust, fireball, heating_up, firestorm
0:37.960 standard_rotation o pyroblast Fluffy_Pillow 44660.0/50000: 89% mana bloodlust, fireball, hot_streak, firestorm
0:38.855 standard_rotation w fireball Fluffy_Pillow 44555.0/50000: 89% mana bloodlust, fireball, heating_up
0:39.755 standard_rotation r fire_blast Fluffy_Pillow 45455.0/50000: 91% mana bloodlust, fireball, heating_up
0:40.196 standard_rotation p pyroblast Fluffy_Pillow 44396.0/50000: 89% mana bloodlust, fireball, hot_streak
0:41.088 standard_rotation w fireball Fluffy_Pillow 44288.0/50000: 89% mana hot_streak
0:42.829 standard_rotation p pyroblast Fluffy_Pillow 45029.0/50000: 90% mana hot_streak
0:43.991 standard_rotation w fireball Fluffy_Pillow 45191.0/50000: 90% mana fireball, heating_up
0:45.291 standard_rotation r fire_blast Fluffy_Pillow 46491.0/50000: 93% mana fireball, heating_up
0:45.733 standard_rotation p pyroblast Fluffy_Pillow 45433.0/50000: 91% mana fireball, hot_streak
0:46.897 standard_rotation w fireball Fluffy_Pillow 45597.0/50000: 91% mana hot_streak
0:48.641 standard_rotation p pyroblast Fluffy_Pillow 46341.0/50000: 93% mana hot_streak
0:49.802 standard_rotation w fireball Fluffy_Pillow 46502.0/50000: 93% mana heating_up
0:51.544 standard_rotation w fireball Fluffy_Pillow 47244.0/50000: 94% mana heating_up
0:53.286 combustion_phase c fireball Fluffy_Pillow 47986.0/50000: 96% mana hot_streak
0:54.586 combustion_phase W combustion Fluffy_Pillow 49286.0/50000: 99% mana fireball, hot_streak
0:55.028 combustion_phase Z pyroblast Fluffy_Pillow 43728.0/50000: 87% mana combustion, fireball, hot_streak, rune_of_power
0:56.189 combustion_phase Z pyroblast Fluffy_Pillow 43889.0/50000: 88% mana combustion, hot_streak, rune_of_power
0:56.189 combustion_phase U fire_blast Fluffy_Pillow 42889.0/50000: 86% mana combustion, rune_of_power
0:57.353 combustion_phase Z pyroblast Fluffy_Pillow 43553.0/50000: 87% mana combustion, hot_streak, rune_of_power
0:57.353 combustion_phase U fire_blast Fluffy_Pillow 42553.0/50000: 85% mana combustion, rune_of_power
0:58.516 combustion_phase Z pyroblast Fluffy_Pillow 43216.0/50000: 86% mana combustion, hot_streak, rune_of_power
0:58.516 combustion_phase U fire_blast Fluffy_Pillow 42216.0/50000: 84% mana combustion, rune_of_power
0:59.678 combustion_phase Z pyroblast Fluffy_Pillow 42878.0/50000: 86% mana combustion, hot_streak, rune_of_power
1:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 42178.0/50000: 84% mana combustion, rune_of_power
1:00.840 combustion_phase b phoenix_flames Fluffy_Pillow 43040.0/50000: 86% mana combustion, heating_up, rune_of_power, gladiators_badge
1:02.002 combustion_phase Z pyroblast Fluffy_Pillow 44202.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:03.164 combustion_phase b phoenix_flames Fluffy_Pillow 44364.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
1:04.327 combustion_phase Z pyroblast Fluffy_Pillow 45527.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:04.327 combustion_phase U fire_blast Fluffy_Pillow 44527.0/50000: 89% mana combustion, rune_of_power, gladiators_badge
1:05.489 combustion_phase Z pyroblast Fluffy_Pillow 45189.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:06.652 default O rune_of_power Fluffy_Pillow 45352.0/50000: 91% mana heating_up, gladiators_badge
1:07.815 rop_phase n fireball Fluffy_Pillow 46515.0/50000: 93% mana heating_up, rune_of_power, gladiators_badge
1:09.556 rop_phase n fireball Fluffy_Pillow 47256.0/50000: 95% mana heating_up, rune_of_power, gladiators_badge
1:11.298 rop_phase g pyroblast Fluffy_Pillow 47998.0/50000: 96% mana hot_streak, rune_of_power, gladiators_badge
1:12.460 rop_phase n fireball Fluffy_Pillow 48160.0/50000: 96% mana fireball, rune_of_power, gladiators_badge
1:14.201 rop_phase n fireball Fluffy_Pillow 48901.0/50000: 98% mana fireball, rune_of_power, gladiators_badge
1:15.501 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
1:15.941 rop_phase g pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak, rune_of_power
1:17.103 rop_phase n fireball Fluffy_Pillow 49102.0/50000: 98% mana heating_up, rune_of_power
1:18.843 rop_phase l phoenix_flames Fluffy_Pillow 49003.0/50000: 98% mana heating_up, rune_of_power
1:20.007 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
1:21.748 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
1:22.910 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana heating_up
1:24.210 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:24.651 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:25.812 standard_rotation w fireball Fluffy_Pillow 49102.0/50000: 98% mana fireball
1:27.554 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:28.854 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:29.296 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
1:30.459 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
1:32.199 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
1:33.940 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:35.340 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:35.682 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak
1:36.845 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:38.587 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:40.328 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:42.068 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana heating_up
1:43.809 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:45.552 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
1:46.852 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:47.295 standard_rotation p pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak
1:48.458 standard_rotation w fireball Fluffy_Pillow 49106.0/50000: 98% mana fireball
1:50.201 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
1:51.943 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:53.243 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:53.685 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
1:54.846 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
1:56.588 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:58.330 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:00.071 default M mirror_image Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:01.233 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana hot_streak
2:02.975 standard_rotation p pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
2:04.137 standard_rotation w fireball Fluffy_Pillow 49167.0/50000: 98% mana fireball
2:05.879 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:07.179 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
2:07.179 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power
2:07.621 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power
2:07.621 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, gladiators_badge
2:08.782 combustion_phase Z pyroblast Fluffy_Pillow 45103.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:08.782 combustion_phase U fire_blast Fluffy_Pillow 44103.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:09.945 combustion_phase Z pyroblast Fluffy_Pillow 44766.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:11.109 combustion_phase b phoenix_flames Fluffy_Pillow 44930.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
2:12.271 combustion_phase Z pyroblast Fluffy_Pillow 46092.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:13.434 combustion_phase U fire_blast Fluffy_Pillow 46255.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:13.434 combustion_phase Z pyroblast Fluffy_Pillow 45755.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:14.597 combustion_phase d scorch Fluffy_Pillow 45918.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:15.761 combustion_phase a pyroblast Fluffy_Pillow 46582.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:16.931 combustion_phase d scorch Fluffy_Pillow 46752.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
2:18.093 combustion_phase a pyroblast Fluffy_Pillow 47414.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
2:19.266 default O rune_of_power Fluffy_Pillow 47587.0/50000: 95% mana heating_up, firestorm, gladiators_badge
2:20.429 rop_phase f pyroblast Fluffy_Pillow 48750.0/50000: 98% mana heating_up, rune_of_power, firestorm, gladiators_badge
2:21.591 rop_phase f pyroblast Fluffy_Pillow 48912.0/50000: 98% mana hot_streak, rune_of_power, firestorm, gladiators_badge
2:22.754 rop_phase f pyroblast Fluffy_Pillow 49075.0/50000: 98% mana heating_up, rune_of_power, firestorm
2:23.916 rop_phase f pyroblast Fluffy_Pillow 49237.0/50000: 98% mana hot_streak, rune_of_power, firestorm
2:25.080 rop_phase f pyroblast Fluffy_Pillow 49401.0/50000: 99% mana heating_up, rune_of_power, firestorm
2:26.244 rop_phase g pyroblast Fluffy_Pillow 49565.0/50000: 99% mana hot_streak, rune_of_power
2:27.405 rop_phase n fireball Fluffy_Pillow 49726.0/50000: 99% mana rune_of_power
2:28.905 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
2:29.146 default N use_item_dreadfire_vessel Fluffy_Pillow 48741.0/50000: 97% mana heating_up, rune_of_power
2:29.146 rop_phase n fireball Fluffy_Pillow 48741.0/50000: 97% mana heating_up, rune_of_power
2:30.889 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, rune_of_power
2:32.630 standard_rotation t phoenix_flames Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:33.793 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
2:35.536 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
2:36.699 standard_rotation w fireball Fluffy_Pillow 49169.0/50000: 98% mana heating_up
2:37.999 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:38.440 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
2:39.602 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana hot_streak
2:41.343 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
2:42.505 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball
2:44.247 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:45.989 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:47.729 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
2:49.471 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:51.213 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:52.913 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:52.954 standard_rotation p pyroblast Fluffy_Pillow 48541.0/50000: 97% mana hot_streak
2:54.117 standard_rotation w fireball Fluffy_Pillow 48704.0/50000: 97% mana fireball
2:55.860 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
2:57.602 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:59.346 standard_rotation w fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball
3:01.088 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
3:02.829 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
3:04.571 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4)
3:06.310 default O rune_of_power Fluffy_Pillow 49002.0/50000: 98% mana fireball(5)
3:07.473 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(6), rune_of_power
3:07.473 rop_phase n fireball Fluffy_Pillow 49500.0/50000: 99% mana fireball(6), heating_up, rune_of_power
3:08.773 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(6), heating_up, rune_of_power
3:09.216 rop_phase g pyroblast Fluffy_Pillow 48943.0/50000: 98% mana fireball(6), hot_streak, rune_of_power
3:10.377 rop_phase n fireball Fluffy_Pillow 49104.0/50000: 98% mana heating_up, rune_of_power
3:11.677 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
3:12.118 rop_phase g pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, rune_of_power
3:13.279 rop_phase n fireball Fluffy_Pillow 49102.0/50000: 98% mana fireball, rune_of_power
3:15.021 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
3:16.763 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), rune_of_power
3:18.063 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
3:18.504 combustion_phase c fireball Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, rune_of_power
3:19.804 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
3:20.246 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44442.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power
3:20.246 combustion_phase Z pyroblast Fluffy_Pillow 44442.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, gladiators_badge
3:21.409 combustion_phase Z pyroblast Fluffy_Pillow 44605.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:22.572 combustion_phase b phoenix_flames Fluffy_Pillow 44768.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:23.734 combustion_phase Z pyroblast Fluffy_Pillow 45930.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:23.734 combustion_phase U fire_blast Fluffy_Pillow 44930.0/50000: 90% mana combustion, rune_of_power, gladiators_badge
3:24.895 combustion_phase Z pyroblast Fluffy_Pillow 45591.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:26.058 combustion_phase b phoenix_flames Fluffy_Pillow 45754.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:27.220 combustion_phase Z pyroblast Fluffy_Pillow 46916.0/50000: 94% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:28.383 combustion_phase d scorch Fluffy_Pillow 47079.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
3:29.546 combustion_phase a pyroblast Fluffy_Pillow 47742.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
3:30.656 combustion_phase U fire_blast Fluffy_Pillow 47852.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
3:30.717 combustion_phase Z pyroblast Fluffy_Pillow 47413.0/50000: 95% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:31.881 standard_rotation w fireball Fluffy_Pillow 47577.0/50000: 95% mana heating_up, gladiators_badge
3:33.624 standard_rotation w fireball Fluffy_Pillow 48320.0/50000: 97% mana heating_up, gladiators_badge
3:35.364 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
3:37.105 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:38.846 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
3:40.589 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(4)
3:41.989 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:42.331 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak
3:43.494 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
3:45.237 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
3:46.398 standard_rotation q pyroblast Fluffy_Pillow 49167.0/50000: 98% mana hot_streak, firestorm
3:47.198 standard_rotation r fire_blast Fluffy_Pillow 48967.0/50000: 98% mana heating_up, firestorm
3:47.561 standard_rotation o pyroblast Fluffy_Pillow 48830.0/50000: 98% mana hot_streak, firestorm
3:48.723 standard_rotation o pyroblast Fluffy_Pillow 48992.0/50000: 98% mana heating_up, firestorm
3:49.886 standard_rotation o pyroblast Fluffy_Pillow 49155.0/50000: 98% mana hot_streak, firestorm
3:51.047 standard_rotation v scorch Fluffy_Pillow 49316.0/50000: 99% mana heating_up
3:52.210 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
3:53.382 default O rune_of_power Fluffy_Pillow 49677.0/50000: 99% mana
3:54.544 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
3:54.544 rop_phase m scorch Fluffy_Pillow 49500.0/50000: 99% mana heating_up, rune_of_power
3:55.707 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
3:56.879 rop_phase m scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up, rune_of_power
3:58.041 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
3:59.214 default N use_item_dreadfire_vessel Fluffy_Pillow 49677.0/50000: 99% mana heating_up, rune_of_power
3:59.214 rop_phase m scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up, rune_of_power
4:00.378 default M mirror_image Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
4:01.540 rop_phase g pyroblast Fluffy_Pillow 49668.0/50000: 99% mana hot_streak, rune_of_power
4:01.540 rop_phase h fire_blast Fluffy_Pillow 48668.0/50000: 97% mana rune_of_power
4:02.703 rop_phase m scorch Fluffy_Pillow 49331.0/50000: 99% mana rune_of_power
4:03.864 rop_phase m scorch Fluffy_Pillow 49503.0/50000: 99% mana rune_of_power
4:05.024 rop_phase k pyroblast Fluffy_Pillow 49502.0/50000: 99% mana heating_up, rune_of_power
4:06.200 rop_phase m scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, rune_of_power
4:07.363 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:08.537 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:09.242 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
4:09.700 standard_rotation s pyroblast Fluffy_Pillow 49458.0/50000: 99% mana heating_up
4:10.872 standard_rotation v scorch Fluffy_Pillow 49630.0/50000: 99% mana
4:12.035 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:13.196 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:14.368 standard_rotation v scorch Fluffy_Pillow 49675.0/50000: 99% mana
4:15.528 standard_rotation v scorch Fluffy_Pillow 49502.0/50000: 99% mana
4:16.690 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:17.865 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:17.865 standard_rotation r fire_blast Fluffy_Pillow 49679.0/50000: 99% mana
4:19.027 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:20.200 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up
4:21.363 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:22.534 standard_rotation o pyroblast Fluffy_Pillow 49676.0/50000: 99% mana heating_up, firestorm
4:23.696 standard_rotation o pyroblast Fluffy_Pillow 49838.0/50000: 100% mana hot_streak, firestorm
4:24.860 standard_rotation o pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
4:26.022 standard_rotation q pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:27.184 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana
4:28.348 combustion_phase c fireball Fluffy_Pillow 49506.0/50000: 99% mana
4:29.648 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:29.648 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power
4:30.090 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power
4:30.090 combustion_phase Z pyroblast Fluffy_Pillow 43942.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:31.253 combustion_phase Z pyroblast Fluffy_Pillow 44105.0/50000: 88% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:32.417 combustion_phase Y pyroblast Fluffy_Pillow 44269.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:33.579 combustion_phase Y pyroblast Fluffy_Pillow 44431.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:34.742 combustion_phase Y pyroblast Fluffy_Pillow 44594.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:35.906 combustion_phase Z pyroblast Fluffy_Pillow 44758.0/50000: 90% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:35.906 combustion_phase U fire_blast Fluffy_Pillow 43758.0/50000: 88% mana combustion, rune_of_power, firestorm, gladiators_badge
4:37.070 combustion_phase Y pyroblast Fluffy_Pillow 44422.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:38.232 combustion_phase Y pyroblast Fluffy_Pillow 44584.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:39.394 combustion_phase Y pyroblast Fluffy_Pillow 44746.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:40.194 combustion_phase U fire_blast Fluffy_Pillow 44546.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
4:40.556 combustion_phase Z pyroblast Fluffy_Pillow 44408.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:41.719 default O rune_of_power Fluffy_Pillow 44571.0/50000: 89% mana heating_up, gladiators_badge
4:42.882 rop_phase l phoenix_flames Fluffy_Pillow 45734.0/50000: 91% mana heating_up, rune_of_power, gladiators_badge
4:44.045 rop_phase m scorch Fluffy_Pillow 46897.0/50000: 94% mana rune_of_power, gladiators_badge
4:45.207 rop_phase m scorch Fluffy_Pillow 47559.0/50000: 95% mana rune_of_power
4:46.369 rop_phase k pyroblast Fluffy_Pillow 48221.0/50000: 96% mana heating_up, rune_of_power
4:47.542 rop_phase m scorch Fluffy_Pillow 48394.0/50000: 97% mana rune_of_power
4:47.847 rop_phase h fire_blast Fluffy_Pillow 48694.0/50000: 97% mana rune_of_power
4:48.705 rop_phase k pyroblast Fluffy_Pillow 48557.0/50000: 97% mana heating_up, rune_of_power
4:49.878 rop_phase m scorch Fluffy_Pillow 48730.0/50000: 97% mana rune_of_power
4:51.040 rop_phase m scorch Fluffy_Pillow 49392.0/50000: 99% mana rune_of_power
4:52.201 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
4:53.375 rop_phase m scorch Fluffy_Pillow 49677.0/50000: 99% mana rune_of_power
4:54.538 rop_phase m scorch Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power
4:55.700 standard_rotation r fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:55.700 standard_rotation q pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
4:56.863 standard_rotation q pyroblast Fluffy_Pillow 49167.0/50000: 98% mana hot_streak
4:58.025 standard_rotation t phoenix_flames Fluffy_Pillow 49329.0/50000: 99% mana heating_up
4:59.187 standard_rotation t phoenix_flames Fluffy_Pillow 50000.0/50000: 100% mana
5:00.349 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana
5:01.512 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
5:02.675 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
5:03.848 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
5:03.848 standard_rotation r fire_blast Fluffy_Pillow 49678.0/50000: 99% mana
5:05.011 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
5:06.183 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up, firestorm
5:07.345 standard_rotation o pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, firestorm
5:08.508 standard_rotation o pyroblast Fluffy_Pillow 49667.0/50000: 99% mana hot_streak, firestorm
5:09.670 standard_rotation t phoenix_flames Fluffy_Pillow 49829.0/50000: 100% mana heating_up
5:10.832 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana
5:11.010 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
5:11.993 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
5:13.167 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
5:14.331 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
5:15.493 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
5:16.666 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
5:17.828 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
5:18.990 standard_rotation r fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
5:18.990 standard_rotation q pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, firestorm

Stats

Level Bonus (60) Race Bonus (kul_tiran) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 -2 304 304 0
Stamina 414 2 2020 1924 1508
Intellect 450 -1 1815 1634 1108 (132)
Spirit 0 0 0 0 0
Health 40400 38480 0
Mana 50000 50000 0
Spell Power 1815 1634 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 8.25% 8.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="kul_tiran"
source=default
spec=fire
level=60
race=kul_tiran
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

lightforged draenei : 5096 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5096.4 5096.4 9.4 / 0.185% 766.0 / 15.0% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
794.1 789.2 Mana 0.00% 57.3 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lightforged draenei 5096
Conflagration Flare Up 23 0.5% 29.9 9.74sec 235 0 Direct 29.9 150 374 235 38.2%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.86 29.86 0.00 0.00 0.0000 0.0000 7026.99 7026.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.80% 18.46 4 34 149.82 130 255 149.85 133 187 2765 2765 0.00%
crit 38.20% 11.41 1 24 373.50 260 510 374.07 263 486 4262 4262 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.8 110.10sec 3899 3356 Direct 0.8 0 3899 3899 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.83 0.83 0.00 0.00 1.1625 0.0000 3224.72 3224.72 0.00% 3355.59 3355.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.83 0 4 3898.71 3786 4398 2326.97 0 4398 3225 3225 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [f]:0.83
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 159 3.1% 3.3 103.77sec 14503 0 Direct 3.3 11649 23317 14550 24.9%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.28 3.27 0.00 0.00 0.0000 0.0000 47638.72 47638.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.11% 2.46 0 4 11649.13 11342 12023 11490.53 0 12023 28639 28639 0.00%
crit 24.89% 0.81 0 3 23317.39 22685 24046 14211.01 0 24046 19000 19000 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 600 11.8% 42.2 7.15sec 4265 0 Direct 42.2 0 4265 4265 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.18 42.18 0.00 0.00 0.0000 0.0000 179894.63 179894.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.18 33 50 4264.97 3045 5979 4267.01 4029 4525 179895 179895 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [V]:16.76
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [i]:2.98
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [j]:5.33
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [s]:17.11
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 608 (636) 11.9% (12.5%) 76.9 3.43sec 2482 1497 Direct 76.9 (219.8) 1654 3445 2373 40.1% (40.1%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 76.95 76.93 0.00 0.00 1.6581 0.0000 182543.02 182543.02 0.00% 1496.61 1496.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.90% 46.08 25 63 1654.42 1437 2575 1655.18 1535 1849 76244 76244 0.00%
crit 40.10% 30.85 18 45 3445.39 2874 5643 3448.76 3218 3772 106299 106299 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [d]:4.68
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [o]:20.61
    standard_rotation
    [x]:51.69
    Conflagration 28 0.5% 76.9 3.41sec 109 0 Periodic 142.8 36 90 59 42.9% 68.9%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 76.93 0.00 142.82 142.82 0.0000 1.4492 8406.10 8406.10 0.00% 40.61 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.15% 81.62 56 113 35.52 0 57 35.52 33 38 2899 2899 0.00%
crit 42.85% 61.20 41 82 89.98 0 125 90.07 82 98 5507 5507 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 952 18.7% 263.0 1.14sec 1086 0 Periodic 299.2 955 0 955 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 263.03 0.00 299.20 299.20 0.0000 1.0000 285626.19 285626.19 0.00% 954.63 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 954.51 50 2908 955.81 817 1169 285626 285626 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Light's Judgment 0 (65) 0.0% (1.3%) 2.0 159.05sec 9639 8294

Stats Details: Lights Judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 0.00 0.00 1.1625 0.0000 0.00 0.00 0.00% 8294.42 8294.42

Action Details: Lights Judgment

  • id:255647
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:150.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:255647
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards after 3 sec.

Action Priority List

    combustion_phase
    [U]:2.01
  • if_expr:buff.combustion.down
    Light's Judgment (_damage) 65 1.3% 2.0 210.06sec 9650 0 Direct 2.0 7813 15617 9652 23.6%

Stats Details: Lights Judgment Damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 19350.89 19350.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.44% 1.53 0 3 7813.36 6135 8605 7417.53 0 8605 11976 11976 0.00%
crit 23.56% 0.47 0 2 15616.59 12270 17211 6584.23 0 17211 7375 7375 0.00%

Action Details: Lights Judgment Damage

  • id:256893
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:150.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:256893
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards.
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.45sec 3651 4722

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7735 0.0000 0.00 0.00 0.00% 4721.70 4721.70

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 97  / 37 0.7% 236.0 3.46sec 46 33 Direct 235.2 37 74 46 24.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.96 235.19 0.00 0.00 1.3988 0.0000 10911.85 10911.85 0.00% 33.06 33.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.45% 177.45 119 208 37.25 29 53 37.34 35 41 6610 6610 0.00%
crit 24.55% 57.75 30 83 74.49 57 106 74.68 64 88 4301 4301 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.68
Phoenix Flames 0 (241) 0.0% (4.7%) 14.1 21.68sec 5128 4656

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.08 0.00 0.00 0.00 1.1014 0.0000 0.00 0.00 0.00% 4655.63 4655.63

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [c]:10.02
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [m]:1.38
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [u]:2.68
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 241 4.7% 14.0 21.69sec 5140 0 Direct 14.0 2101 5980 5142 78.4%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 0.00 0.00 0.0000 0.0000 72185.53 72185.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.63% 3.04 0 9 2101.12 1730 3397 2061.35 0 3205 6382 6382 0.00%
crit 78.37% 11.01 6 16 5979.85 3460 6795 5985.27 5240 6436 65804 65804 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2035 (2166) 39.9% (42.5%) 96.1 3.11sec 6764 6053 Direct 96.7 (274.3) 3068 7764 6312 69.1% (69.1%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.06 96.74 0.00 0.00 1.1174 0.0000 610613.95 610613.95 0.00% 6053.27 6053.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 30.91% 29.90 17 45 3067.85 2620 5145 3068.00 2746 3319 91741 91741 0.00%
crit 69.09% 66.84 39 111 7763.69 5240 10290 7788.15 7023 8805 518873 518873 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Z]:7.08
  • if_expr:buff.firestorm.react
    combustion_phase
    [a]:25.78
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [b]:2.94
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [g]:4.83
  • if_expr:buff.firestorm.react
    rop_phase
    [h]:9.41
  • if_expr:buff.hot_streak.react
    rop_phase
    [l]:3.28
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [p]:12.40
  • if_expr:buff.firestorm.react
    standard_rotation
    [q]:15.30
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [r]:4.17
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [t]:10.85
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 130 2.6% 96.7 3.11sec 404 0 Periodic 177.6 137 349 220 39.5% 86.4%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.74 0.00 177.59 177.59 0.0000 1.4623 39114.08 39114.08 0.00% 150.61 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.51% 107.45 71 145 136.53 5 234 136.55 130 145 14671 14671 0.00%
crit 39.49% 70.14 47 102 348.53 10 468 349.04 324 386 24443 24443 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 208 4.1% 33.2 7.77sec 1888 1637 Direct 33.2 0 1889 1889 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.16 33.15 0.00 0.00 1.1538 0.0000 62612.12 62612.12 0.00% 1636.62 1636.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.15 17 51 1888.62 1150 3341 1888.70 1682 2184 62612 62612 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [e]:3.43
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [n]:7.91
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [w]:22.20
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
lightforged draenei
Combustion 4.7 71.04sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [X]:4.66
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lightforged draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lightforged draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 301.76sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.20
Rune of Power 5.3 60.74sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.26 0.00 0.00 0.00 1.1115 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.28
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.9sec 70.9sec 11.8sec 18.37% 0.00% 105.5 (105.5) 4.5

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:50.5s / 87.6s
  • trigger_min/max:50.5s / 87.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • combustion_1:18.37%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.5 24.6 9.1sec 4.2sec 5.1sec 36.66% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 54.8s
  • trigger_min/max:1.3s / 54.8s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 34.2s

Stack Uptimes

  • fireball_1:20.48%
  • fireball_2:9.01%
  • fireball_3:4.39%
  • fireball_4:1.89%
  • fireball_5:0.68%
  • fireball_6:0.18%
  • fireball_7:0.03%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.7 0.8 36.7sec 32.7sec 4.2sec 10.89% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 181.6s
  • trigger_min/max:0.8s / 181.6s
  • trigger_pct:10.15%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • firestorm_1:10.89%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.6sec 73.1sec 14.7sec 22.87% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 87.6s
  • trigger_min/max:60.0s / 87.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.87%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 95.9 0.0 3.1sec 3.1sec 1.1sec 35.26% 46.69% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.1s
  • trigger_min/max:0.2s / 19.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • heating_up_1:35.26%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.0 0.0 3.6sec 3.6sec 0.6sec 13.04% 86.58% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 30.2s
  • trigger_min/max:0.5s / 30.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s

Stack Uptimes

  • hot_streak_1:13.04%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 305.6sec 305.6sec 23.8sec 9.49% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 358.3s
  • trigger_min/max:300.0s / 358.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.49%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.7 0.2 31.8sec 31.2sec 11.9sec 38.74% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 71.4s
  • trigger_min/max:2.5s / 71.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s

Stack Uptimes

  • rune_of_power_1:38.74%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 95.9 72.0 124.0 3.1s 0.2s 19.1s
Heating Up removed 11.5 1.0 24.0 23.5s 0.9s 198.5s
Heating Up converted with Fire Blast 23.3 13.0 35.0 12.1s 0.5s 100.6s
Hot Streak procs 84.0 61.0 113.0 3.6s 0.5s 30.2s
Hot Streak spells used 263.1 210.0 319.0 1.1s 0.0s 5.1s
Hot Streak spell crits 184.0 139.0 242.0 1.6s 0.0s 17.3s
Hot Streak spell crits wasted 4.2 0.0 11.0 68.1s 0.1s 313.1s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.54% 10.05% 18.21% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3490.0004.3511.0450.0005.025
Rune of Power14.3720.00037.66077.84515.026131.693
Fire Blast0.1160.00025.3184.8932.05827.381
Dragon's Breath134.79645.318314.270285.938205.023359.785
Combustion2.5841.30011.68012.1107.34024.120
Phoenix Flames0.3000.00027.5364.2242.49827.536

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
lightforged draenei
mana_regen Mana 2178.61 237133.23 100.00% 108.85 63020.00 21.00%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 789.22 794.13 63012.8 48525.6 42267.0 50000.0
Usage Type Count Total Avg RPE APR
lightforged draenei
combustion Mana 4.7 23315.1 5000.0 5003.4 0.0
dragons_breath Mana 0.8 1652.6 2000.0 1998.3 2.0
fire_blast Mana 42.2 21089.2 500.0 500.0 8.5
fireball Mana 77.0 76966.5 1000.0 1000.3 2.5
mirror_image Mana 3.0 1988.5 665.4 665.4 5.5
pyroblast Mana 97.0 97041.0 1000.0 1010.2 6.7
scorch Mana 33.2 16577.0 500.0 499.9 3.8

Statistics & Data Analysis

Fight Length
lightforged draenei Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
lightforged draenei Damage Per Second
Count 1717
Mean 5096.36
Minimum 4402.70
Maximum 5970.71
Spread ( max - min ) 1568.01
Range [ ( max - min ) / 2 * 100% ] 15.38%
Standard Deviation 199.3796
5th Percentile 4805.82
95th Percentile 5455.38
( 95th Percentile - 5th Percentile ) 649.56
Mean Distribution
Standard Deviation 4.8117
95.00% Confidence Interval ( 5086.93 - 5105.79 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5880
0.1 Scale Factor Error with Delta=300 340
0.05 Scale Factor Error with Delta=300 1358
0.01 Scale Factor Error with Delta=300 33935
Priority Target DPS
lightforged draenei Priority Target Damage Per Second
Count 1717
Mean 5096.36
Minimum 4402.70
Maximum 5970.71
Spread ( max - min ) 1568.01
Range [ ( max - min ) / 2 * 100% ] 15.38%
Standard Deviation 199.3796
5th Percentile 4805.82
95th Percentile 5455.38
( 95th Percentile - 5th Percentile ) 649.56
Mean Distribution
Standard Deviation 4.8117
95.00% Confidence Interval ( 5086.93 - 5105.79 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5880
0.1 Scale Factor Error with Delta=300 340
0.05 Scale Factor Error with Delta=300 1358
0.01 Scale Factor Error with Delta=300 33935
DPS(e)
lightforged draenei Damage Per Second (Effective)
Count 1717
Mean 5096.36
Minimum 4402.70
Maximum 5970.71
Spread ( max - min ) 1568.01
Range [ ( max - min ) / 2 * 100% ] 15.38%
Damage
lightforged draenei Damage
Count 1717
Mean 1518236.92
Minimum 1165808.50
Maximum 2003706.94
Spread ( max - min ) 837898.43
Range [ ( max - min ) / 2 * 100% ] 27.59%
DTPS
lightforged draenei Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
lightforged draenei Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
lightforged draenei Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
lightforged draenei Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
lightforged draenei Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
lightforged draenei Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
lightforged draeneiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
lightforged draenei Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.28 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.28 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.20 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.66 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
U 2.01 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
V 16.76 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
W 0.00 call_action_list,name=active_talents
X 4.66 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Y 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Z 7.08 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
a 25.78 pyroblast,if=buff.hot_streak.react&buff.combustion.up
b 2.94 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
c 10.02 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
d 4.68 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
e 3.43 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
f 0.83 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
g 4.83 pyroblast,if=buff.firestorm.react
h 9.41 pyroblast,if=buff.hot_streak.react
i 2.98 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
j 5.33 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
k 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
l 3.28 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
m 1.38 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
n 7.91 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
o 20.61 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
p 12.40 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
q 15.30 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
r 4.17 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
s 17.11 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
t 10.85 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
u 2.68 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
v 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
w 22.20 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
x 51.69 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLUTSdXVaaVaVacacaVacaebVOhooooNojhoooxsqxxsqxxxxxqxxxsqxsqxxxsqxqxxxxxdXVTcaVacaVaebebOmoooojhgggxsqxsqpppxqxsqxNxxxsqxMxxxsqxxxxxxdXVTcaVacaVaebZZOojhomooooxsqxxxsqxsqxxxxqxxxsqxsqxxpppxxxxUdXTaaVaVaVacacaVaOnlnnlinnNlnlnsruwMwtwstwwtwwsrwwtpppsrppprwtwwtwwtwwtwtdXVTaZZZZaVaVaVacOhnnjhnnlggjgmuwwtwstwwtp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask lightforged draenei 50000.0/50000: 100% mana
Pre precombat 1 food lightforged draenei 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_phase U lights_judgment Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana
0:01.163 combustion_cooldowns S potion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, heating_up, gladiators_badge
0:01.163 combustion_phase d fireball Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, heating_up, gladiators_badge, potion_of_spectral_intellect
0:02.063 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, heating_up, gladiators_badge, potion_of_spectral_intellect
0:02.063 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.504 combustion_phase a pyroblast Fluffy_Pillow 43941.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.398 combustion_phase a pyroblast Fluffy_Pillow 43835.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.398 combustion_phase V fire_blast Fluffy_Pillow 42835.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.293 combustion_phase a pyroblast Fluffy_Pillow 43230.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.293 combustion_phase V fire_blast Fluffy_Pillow 42230.0/50000: 84% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.187 combustion_phase a pyroblast Fluffy_Pillow 42624.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.081 combustion_phase c phoenix_flames Fluffy_Pillow 42518.0/50000: 85% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.977 combustion_phase a pyroblast Fluffy_Pillow 43414.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.872 combustion_phase c phoenix_flames Fluffy_Pillow 43309.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.767 combustion_phase a pyroblast Fluffy_Pillow 44204.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.767 combustion_phase V fire_blast Fluffy_Pillow 43204.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.663 combustion_phase a pyroblast Fluffy_Pillow 43600.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.558 combustion_phase c phoenix_flames Fluffy_Pillow 43495.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.452 combustion_phase a pyroblast Fluffy_Pillow 44389.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.346 combustion_phase e scorch Fluffy_Pillow 44283.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.240 combustion_phase b pyroblast Fluffy_Pillow 44677.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.951 combustion_phase V fire_blast Fluffy_Pillow 44388.0/50000: 89% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:14.146 default O rune_of_power Fluffy_Pillow 44083.0/50000: 88% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:15.039 rop_phase h pyroblast Fluffy_Pillow 44976.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:15.934 rop_phase o fireball Fluffy_Pillow 44871.0/50000: 90% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.272 rop_phase o fireball Fluffy_Pillow 45209.0/50000: 90% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:18.614 rop_phase o fireball Fluffy_Pillow 45551.0/50000: 91% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:19.955 rop_phase o fireball Fluffy_Pillow 45892.0/50000: 92% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:21.295 default N use_item_dreadfire_vessel Fluffy_Pillow 46232.0/50000: 92% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:21.295 rop_phase o fireball Fluffy_Pillow 46232.0/50000: 92% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:22.495 rop_phase j fire_blast Fluffy_Pillow 47432.0/50000: 95% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:22.636 rop_phase h pyroblast Fluffy_Pillow 46073.0/50000: 92% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:23.528 rop_phase o fireball Fluffy_Pillow 45965.0/50000: 92% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:24.868 rop_phase o fireball Fluffy_Pillow 46305.0/50000: 93% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:26.207 rop_phase o fireball Fluffy_Pillow 46644.0/50000: 93% mana bloodlust, fireball, rune_of_power
0:27.550 standard_rotation x fireball Fluffy_Pillow 46987.0/50000: 94% mana bloodlust, fireball(2)
0:28.850 standard_rotation s fire_blast Fluffy_Pillow 48287.0/50000: 97% mana bloodlust, heating_up
0:28.890 standard_rotation q pyroblast Fluffy_Pillow 46827.0/50000: 94% mana bloodlust, hot_streak
0:29.784 standard_rotation x fireball Fluffy_Pillow 46721.0/50000: 93% mana bloodlust, fireball
0:31.125 standard_rotation x fireball Fluffy_Pillow 47062.0/50000: 94% mana bloodlust, fireball
0:32.225 standard_rotation s fire_blast Fluffy_Pillow 48162.0/50000: 96% mana bloodlust, heating_up
0:32.466 standard_rotation q pyroblast Fluffy_Pillow 46903.0/50000: 94% mana bloodlust, hot_streak
0:33.360 standard_rotation x fireball Fluffy_Pillow 46797.0/50000: 94% mana bloodlust, fireball
0:34.702 standard_rotation x fireball Fluffy_Pillow 47139.0/50000: 94% mana bloodlust, fireball
0:36.042 standard_rotation x fireball Fluffy_Pillow 47479.0/50000: 95% mana bloodlust, fireball(2)
0:37.383 standard_rotation x fireball Fluffy_Pillow 47820.0/50000: 96% mana bloodlust, heating_up
0:38.726 standard_rotation x fireball Fluffy_Pillow 48163.0/50000: 96% mana bloodlust, hot_streak
0:40.067 standard_rotation q pyroblast Fluffy_Pillow 48504.0/50000: 97% mana bloodlust, hot_streak
0:40.963 standard_rotation x fireball Fluffy_Pillow 48400.0/50000: 97% mana bloodlust, fireball
0:42.304 standard_rotation x fireball Fluffy_Pillow 48741.0/50000: 97% mana fireball
0:44.044 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
0:45.544 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:45.785 standard_rotation q pyroblast Fluffy_Pillow 48741.0/50000: 97% mana hot_streak
0:46.947 standard_rotation x fireball Fluffy_Pillow 48903.0/50000: 98% mana fireball, heating_up
0:48.247 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
0:48.686 standard_rotation q pyroblast Fluffy_Pillow 48939.0/50000: 98% mana fireball, hot_streak
0:49.848 standard_rotation x fireball Fluffy_Pillow 49101.0/50000: 98% mana fireball(2)
0:51.592 standard_rotation x fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball(2)
0:53.332 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
0:54.632 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:55.073 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
0:56.236 standard_rotation x fireball Fluffy_Pillow 49104.0/50000: 98% mana hot_streak
0:57.977 standard_rotation q pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
0:59.139 standard_rotation x fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball
1:00.879 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
1:02.620 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:04.362 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
1:06.104 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
1:07.846 combustion_phase d fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:09.146 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
1:09.146 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power
1:09.587 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power
1:09.587 combustion_phase c phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, gladiators_badge
1:10.751 combustion_phase a pyroblast Fluffy_Pillow 45105.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:10.751 combustion_phase V fire_blast Fluffy_Pillow 44105.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
1:11.914 combustion_phase a pyroblast Fluffy_Pillow 44768.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:13.077 combustion_phase c phoenix_flames Fluffy_Pillow 44931.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.240 combustion_phase a pyroblast Fluffy_Pillow 46094.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:15.340 combustion_phase V fire_blast Fluffy_Pillow 46194.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
1:15.403 combustion_phase a pyroblast Fluffy_Pillow 45757.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:16.565 combustion_phase e scorch Fluffy_Pillow 45919.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
1:17.727 combustion_phase b pyroblast Fluffy_Pillow 46581.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:18.901 combustion_phase e scorch Fluffy_Pillow 46755.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
1:20.064 combustion_phase b pyroblast Fluffy_Pillow 47418.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
1:21.236 default O rune_of_power Fluffy_Pillow 47590.0/50000: 95% mana heating_up, gladiators_badge
1:22.397 rop_phase m phoenix_flames Fluffy_Pillow 48751.0/50000: 98% mana heating_up, rune_of_power, gladiators_badge
1:23.560 rop_phase o fireball Fluffy_Pillow 49914.0/50000: 100% mana rune_of_power, gladiators_badge
1:25.300 rop_phase o fireball Fluffy_Pillow 49003.0/50000: 98% mana rune_of_power
1:27.042 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
1:28.784 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), rune_of_power
1:30.084 rop_phase j fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
1:30.525 rop_phase h pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, rune_of_power, firestorm
1:31.687 rop_phase g pyroblast Fluffy_Pillow 49103.0/50000: 98% mana hot_streak, rune_of_power, firestorm
1:32.849 rop_phase g pyroblast Fluffy_Pillow 49265.0/50000: 99% mana heating_up, rune_of_power, firestorm
1:34.011 rop_phase g pyroblast Fluffy_Pillow 49427.0/50000: 99% mana hot_streak, rune_of_power, firestorm
1:35.173 standard_rotation x fireball Fluffy_Pillow 49589.0/50000: 99% mana heating_up
1:36.473 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:36.914 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:38.075 standard_rotation x fireball Fluffy_Pillow 49102.0/50000: 98% mana heating_up
1:39.375 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:39.817 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, firestorm
1:40.982 standard_rotation p pyroblast Fluffy_Pillow 49107.0/50000: 98% mana fireball, heating_up, firestorm
1:42.142 standard_rotation p pyroblast Fluffy_Pillow 49267.0/50000: 99% mana fireball, hot_streak, firestorm
1:43.304 standard_rotation p pyroblast Fluffy_Pillow 49429.0/50000: 99% mana fireball, heating_up, firestorm
1:44.467 standard_rotation x fireball Fluffy_Pillow 49592.0/50000: 99% mana fireball, hot_streak
1:46.208 standard_rotation q pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
1:47.372 standard_rotation x fireball Fluffy_Pillow 49168.0/50000: 98% mana heating_up
1:48.672 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:49.113 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:50.277 standard_rotation x fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
1:52.020 default N use_item_dreadfire_vessel Fluffy_Pillow 49006.0/50000: 98% mana fireball
1:52.020 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
1:53.762 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:55.502 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
1:56.902 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:57.243 standard_rotation q pyroblast Fluffy_Pillow 48841.0/50000: 98% mana hot_streak
1:58.407 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, heating_up
2:00.150 default M mirror_image Fluffy_Pillow 49006.0/50000: 98% mana fireball, heating_up
2:01.313 standard_rotation x fireball Fluffy_Pillow 49169.0/50000: 98% mana fireball(2)
2:03.055 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:04.795 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
2:06.095 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:06.537 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:07.699 standard_rotation x fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball, heating_up
2:09.440 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, heating_up
2:11.182 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:12.922 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
2:14.664 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4)
2:16.406 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:18.148 combustion_phase d fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:19.448 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
2:19.448 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power
2:19.888 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power
2:19.888 combustion_phase c phoenix_flames Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, gladiators_badge
2:21.050 combustion_phase a pyroblast Fluffy_Pillow 45102.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:21.050 combustion_phase V fire_blast Fluffy_Pillow 44102.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:22.212 combustion_phase a pyroblast Fluffy_Pillow 44764.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.373 combustion_phase c phoenix_flames Fluffy_Pillow 44925.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
2:24.535 combustion_phase a pyroblast Fluffy_Pillow 46087.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:24.835 combustion_phase V fire_blast Fluffy_Pillow 45387.0/50000: 91% mana combustion, rune_of_power, gladiators_badge
2:25.696 combustion_phase a pyroblast Fluffy_Pillow 45748.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:26.857 combustion_phase e scorch Fluffy_Pillow 45909.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:28.016 combustion_phase b pyroblast Fluffy_Pillow 46568.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:29.194 combustion_phase Z pyroblast Fluffy_Pillow 46746.0/50000: 93% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
2:30.357 combustion_phase Z pyroblast Fluffy_Pillow 46909.0/50000: 94% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:31.520 default O rune_of_power Fluffy_Pillow 47072.0/50000: 94% mana heating_up, firestorm, gladiators_badge
2:32.683 rop_phase o fireball Fluffy_Pillow 48235.0/50000: 96% mana heating_up, rune_of_power, gladiators_badge
2:33.983 rop_phase j fire_blast Fluffy_Pillow 49535.0/50000: 99% mana heating_up, rune_of_power, gladiators_badge
2:34.426 rop_phase h pyroblast Fluffy_Pillow 48478.0/50000: 97% mana hot_streak, rune_of_power, gladiators_badge
2:35.589 rop_phase o fireball Fluffy_Pillow 48641.0/50000: 97% mana fireball, heating_up, rune_of_power
2:37.329 rop_phase m phoenix_flames Fluffy_Pillow 49003.0/50000: 98% mana fireball, heating_up, rune_of_power
2:38.493 rop_phase o fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), rune_of_power
2:40.235 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), rune_of_power
2:41.977 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), rune_of_power
2:43.719 rop_phase o fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4), rune_of_power
2:45.462 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(5)
2:46.862 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:47.204 standard_rotation q pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak
2:48.367 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:50.110 standard_rotation x fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
2:51.851 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:53.151 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:53.594 standard_rotation q pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak
2:54.756 standard_rotation x fireball Fluffy_Pillow 49105.0/50000: 98% mana heating_up
2:56.056 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:56.498 standard_rotation q pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:57.661 standard_rotation x fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
2:59.402 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
3:01.144 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
3:02.885 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:04.627 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
3:05.788 standard_rotation x fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball
3:07.532 standard_rotation x fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball
3:09.274 standard_rotation x fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
3:10.574 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:11.015 standard_rotation q pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
3:12.177 standard_rotation x fireball Fluffy_Pillow 49103.0/50000: 98% mana heating_up
3:13.477 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:13.917 standard_rotation q pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak
3:15.079 standard_rotation x fireball Fluffy_Pillow 49102.0/50000: 98% mana fireball, heating_up
3:16.819 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball, heating_up
3:18.560 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, firestorm
3:19.724 standard_rotation p pyroblast Fluffy_Pillow 49168.0/50000: 98% mana fireball, heating_up, firestorm
3:20.885 standard_rotation p pyroblast Fluffy_Pillow 49329.0/50000: 99% mana fireball, hot_streak, firestorm
3:22.048 standard_rotation x fireball Fluffy_Pillow 49492.0/50000: 99% mana fireball, heating_up
3:23.789 standard_rotation x fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, heating_up
3:25.529 standard_rotation x fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
3:27.273 standard_rotation x fireball Fluffy_Pillow 49007.0/50000: 98% mana heating_up
3:29.014 combustion_phase U lights_judgment Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
3:30.177 combustion_phase d fireball Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
3:31.477 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
3:31.917 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44440.0/50000: 89% mana combustion, hot_streak, rune_of_power
3:31.917 combustion_phase a pyroblast Fluffy_Pillow 44440.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:33.078 combustion_phase a pyroblast Fluffy_Pillow 44601.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:33.078 combustion_phase V fire_blast Fluffy_Pillow 43601.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
3:34.240 combustion_phase a pyroblast Fluffy_Pillow 44263.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:34.240 combustion_phase V fire_blast Fluffy_Pillow 43263.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
3:35.402 combustion_phase a pyroblast Fluffy_Pillow 43925.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:35.402 combustion_phase V fire_blast Fluffy_Pillow 42925.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
3:36.564 combustion_phase a pyroblast Fluffy_Pillow 43587.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:37.727 combustion_phase c phoenix_flames Fluffy_Pillow 43750.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
3:38.888 combustion_phase a pyroblast Fluffy_Pillow 44911.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:40.052 combustion_phase c phoenix_flames Fluffy_Pillow 45075.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:41.215 combustion_phase a pyroblast Fluffy_Pillow 46238.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:42.015 combustion_phase V fire_blast Fluffy_Pillow 46038.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:42.379 combustion_phase a pyroblast Fluffy_Pillow 45902.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:43.541 default O rune_of_power Fluffy_Pillow 46064.0/50000: 92% mana heating_up, gladiators_badge
3:44.704 rop_phase n scorch Fluffy_Pillow 47227.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
3:45.868 rop_phase l pyroblast Fluffy_Pillow 47891.0/50000: 96% mana heating_up, rune_of_power, gladiators_badge
3:47.038 rop_phase n scorch Fluffy_Pillow 48061.0/50000: 96% mana rune_of_power
3:48.200 rop_phase n scorch Fluffy_Pillow 48723.0/50000: 97% mana rune_of_power
3:49.363 rop_phase l pyroblast Fluffy_Pillow 49386.0/50000: 99% mana heating_up, rune_of_power
3:49.731 rop_phase i fire_blast Fluffy_Pillow 48696.0/50000: 97% mana rune_of_power
3:50.534 rop_phase n scorch Fluffy_Pillow 49057.0/50000: 98% mana rune_of_power
3:51.696 rop_phase n scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
3:52.858 default N use_item_dreadfire_vessel Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
3:52.858 rop_phase l pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
3:54.034 rop_phase n scorch Fluffy_Pillow 49680.0/50000: 99% mana heating_up, rune_of_power
3:55.196 rop_phase l pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
3:56.370 rop_phase n scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, rune_of_power
3:57.531 standard_rotation s fire_blast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
3:57.531 standard_rotation r pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak
3:58.692 standard_rotation u phoenix_flames Fluffy_Pillow 49164.0/50000: 98% mana
3:59.855 standard_rotation w scorch Fluffy_Pillow 50000.0/50000: 100% mana
4:01.017 default M mirror_image Fluffy_Pillow 49504.0/50000: 99% mana
4:02.179 standard_rotation w scorch Fluffy_Pillow 49666.0/50000: 99% mana heating_up
4:03.340 standard_rotation t pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:04.516 standard_rotation w scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:05.173 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
4:05.679 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:06.852 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:08.015 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:09.177 standard_rotation t pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:10.352 standard_rotation w scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:11.514 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:12.676 standard_rotation s fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:12.894 standard_rotation r pyroblast Fluffy_Pillow 49222.0/50000: 98% mana hot_streak
4:14.058 standard_rotation w scorch Fluffy_Pillow 49386.0/50000: 99% mana
4:15.222 standard_rotation w scorch Fluffy_Pillow 49506.0/50000: 99% mana
4:16.384 standard_rotation t pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:17.557 standard_rotation p pyroblast Fluffy_Pillow 49677.0/50000: 99% mana heating_up, firestorm
4:18.719 standard_rotation p pyroblast Fluffy_Pillow 49839.0/50000: 100% mana hot_streak, firestorm
4:19.882 standard_rotation p pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
4:20.615 standard_rotation s fire_blast Fluffy_Pillow 49700.0/50000: 99% mana heating_up
4:21.045 standard_rotation r pyroblast Fluffy_Pillow 49663.0/50000: 99% mana hot_streak, firestorm
4:22.206 standard_rotation p pyroblast Fluffy_Pillow 49824.0/50000: 100% mana heating_up, firestorm
4:23.368 standard_rotation p pyroblast Fluffy_Pillow 49986.0/50000: 100% mana hot_streak, firestorm
4:24.531 standard_rotation p pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
4:25.693 standard_rotation r pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:26.856 standard_rotation w scorch Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:28.017 standard_rotation t pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:29.191 standard_rotation w scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:30.354 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:31.516 standard_rotation t pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:32.688 standard_rotation w scorch Fluffy_Pillow 49676.0/50000: 99% mana
4:33.849 standard_rotation w scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:35.012 standard_rotation t pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:36.184 standard_rotation w scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:37.346 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:38.511 standard_rotation t pyroblast Fluffy_Pillow 49507.0/50000: 99% mana heating_up
4:39.681 standard_rotation w scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up
4:40.846 standard_rotation t pyroblast Fluffy_Pillow 49507.0/50000: 99% mana heating_up
4:42.018 combustion_phase d fireball Fluffy_Pillow 49679.0/50000: 99% mana heating_up
4:43.318 combustion_phase X combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:43.318 combustion_phase V fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power
4:43.758 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, hot_streak, rune_of_power
4:43.758 combustion_phase a pyroblast Fluffy_Pillow 43940.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:44.920 combustion_phase Z pyroblast Fluffy_Pillow 44102.0/50000: 88% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:46.083 combustion_phase Z pyroblast Fluffy_Pillow 44265.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:47.246 combustion_phase Z pyroblast Fluffy_Pillow 44428.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:48.409 combustion_phase Z pyroblast Fluffy_Pillow 44591.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:49.570 combustion_phase a pyroblast Fluffy_Pillow 44752.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:49.570 combustion_phase V fire_blast Fluffy_Pillow 43752.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
4:50.733 combustion_phase a pyroblast Fluffy_Pillow 44415.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:50.733 combustion_phase V fire_blast Fluffy_Pillow 43415.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
4:51.896 combustion_phase a pyroblast Fluffy_Pillow 44078.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:51.896 combustion_phase V fire_blast Fluffy_Pillow 43078.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
4:53.060 combustion_phase a pyroblast Fluffy_Pillow 43742.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:54.223 combustion_phase c phoenix_flames Fluffy_Pillow 43905.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.385 default O rune_of_power Fluffy_Pillow 45067.0/50000: 90% mana hot_streak, gladiators_badge
4:56.547 rop_phase h pyroblast Fluffy_Pillow 46229.0/50000: 92% mana hot_streak, rune_of_power, gladiators_badge
4:57.708 rop_phase n scorch Fluffy_Pillow 46390.0/50000: 93% mana rune_of_power, gladiators_badge
4:58.870 rop_phase n scorch Fluffy_Pillow 47052.0/50000: 94% mana rune_of_power
5:00.035 rop_phase j fire_blast Fluffy_Pillow 47717.0/50000: 95% mana heating_up, rune_of_power
5:00.035 rop_phase h pyroblast Fluffy_Pillow 47217.0/50000: 94% mana hot_streak, rune_of_power
5:01.198 rop_phase n scorch Fluffy_Pillow 47380.0/50000: 95% mana rune_of_power
5:02.359 rop_phase n scorch Fluffy_Pillow 48041.0/50000: 96% mana rune_of_power
5:03.521 rop_phase l pyroblast Fluffy_Pillow 48703.0/50000: 97% mana heating_up, rune_of_power
5:04.696 rop_phase g pyroblast Fluffy_Pillow 48878.0/50000: 98% mana heating_up, rune_of_power, firestorm
5:05.859 rop_phase g pyroblast Fluffy_Pillow 49041.0/50000: 98% mana hot_streak, rune_of_power, firestorm
5:06.941 rop_phase j fire_blast Fluffy_Pillow 49041.0/50000: 98% mana heating_up, rune_of_power, firestorm
5:07.021 rop_phase g pyroblast Fluffy_Pillow 48703.0/50000: 97% mana hot_streak, rune_of_power, firestorm
5:08.185 rop_phase m phoenix_flames Fluffy_Pillow 48867.0/50000: 98% mana heating_up, rune_of_power
5:09.348 standard_rotation u phoenix_flames Fluffy_Pillow 50000.0/50000: 100% mana
5:10.510 standard_rotation w scorch Fluffy_Pillow 50000.0/50000: 100% mana
5:11.672 standard_rotation w scorch Fluffy_Pillow 49504.0/50000: 99% mana
5:12.837 standard_rotation t pyroblast Fluffy_Pillow 49507.0/50000: 99% mana heating_up
5:14.009 standard_rotation w scorch Fluffy_Pillow 49679.0/50000: 99% mana
5:14.662 standard_rotation s fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
5:15.173 standard_rotation t pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
5:16.345 standard_rotation w scorch Fluffy_Pillow 49678.0/50000: 99% mana
5:17.508 standard_rotation w scorch Fluffy_Pillow 49505.0/50000: 99% mana
5:18.669 standard_rotation t pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
5:19.844 standard_rotation p pyroblast Fluffy_Pillow 49678.0/50000: 99% mana heating_up, firestorm

Stats

Level Bonus (60) Race Bonus (lightforged_draenei) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 -1 305 305 0
Stamina 414 1 2019 1923 1508
Intellect 450 0 1816 1635 1108 (132)
Spirit 0 0 0 0 0
Health 40380 38460 0
Mana 50000 50000 0
Spell Power 1816 1635 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="lightforged draenei"
source=default
spec=fire
level=60
race=lightforged_draenei
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

mechagnome : 5141 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5140.8 5140.8 9.8 / 0.190% 815.5 / 15.9% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
798.1 793.4 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
mechagnome 5141
Conflagration Flare Up 24 0.5% 29.8 9.73sec 241 0 Direct 29.8 153 383 241 38.4%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.79 29.79 0.00 0.00 0.0000 0.0000 7193.67 7193.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.60% 18.35 4 33 153.47 132 259 153.45 135 180 2817 2817 0.00%
crit 38.40% 11.44 2 25 382.61 264 519 383.04 289 475 4377 4377 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.8 97.57sec 3989 3434 Direct 0.8 0 3989 3989 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.81 0.81 0.00 0.00 1.1625 0.0000 3231.41 3231.41 0.00% 3434.02 3434.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.81 0 4 3989.06 3864 4478 2318.76 0 4478 3231 3231 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.81
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 158 3.1% 3.3 103.91sec 14335 0 Direct 3.3 11648 23304 14418 23.7%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.28 0.00 0.00 0.0000 0.0000 47322.42 47322.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.30% 2.51 0 4 11648.30 11342 12023 11511.01 0 12023 29187 29187 0.00%
crit 23.70% 0.78 0 4 23304.25 22685 24046 13688.28 0 24046 18135 18135 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 611 11.9% 42.3 7.15sec 4335 0 Direct 42.3 0 4335 4335 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.30 42.30 0.00 0.00 0.0000 0.0000 183353.95 183353.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.30 32 50 4335.10 3092 6089 4336.39 4130 4609 183354 183354 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.73
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:2.99
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.28
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.30
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 624 (653) 12.1% (12.7%) 77.4 3.39sec 2532 1522 Direct 77.4 (220.9) 1692 3518 2421 39.9% (39.9%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.42 77.41 0.00 0.00 1.6629 0.0000 187393.92 187393.92 0.00% 1522.36 1522.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.07% 46.50 26 67 1691.71 1459 2628 1692.17 1577 1836 78667 78667 0.00%
crit 39.93% 30.91 18 45 3517.73 2918 5648 3520.59 3288 3833 108727 108727 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.69
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.74
    standard_rotation
    [w]:52.02
    Conflagration 29 0.6% 77.4 3.39sec 111 0 Periodic 143.4 36 92 60 42.6% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.41 0.00 143.45 143.45 0.0000 1.4470 8591.79 8591.79 0.00% 41.39 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.36% 82.29 58 110 36.29 0 58 36.28 34 39 2986 2986 0.00%
crit 42.64% 61.16 42 86 91.65 0 127 91.73 86 100 5606 5606 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 973 18.9% 264.7 1.13sec 1103 0 Periodic 299.2 976 0 976 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.67 0.00 299.20 299.20 0.0000 1.0000 291888.76 291888.76 0.00% 975.56 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 975.63 152 2885 976.85 841 1159 291889 291889 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.45sec 3712 4798

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7737 0.0000 0.00 0.00 0.00% 4798.43 4798.43

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 34 Direct 235.3 38 76 47 24.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.96 235.26 0.00 0.00 1.3988 0.0000 11098.78 11098.78 0.00% 33.63 33.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.66% 177.99 120 214 37.94 29 53 38.02 35 42 6753 6753 0.00%
crit 24.34% 57.27 30 85 75.88 58 106 76.04 68 87 4346 4346 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.68
Phoenix Flames 0 (247) 0.0% (4.8%) 14.1 21.73sec 5239 4759

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.12 0.00 0.00 0.00 1.1010 0.0000 0.00 0.00 0.00% 4758.77 4758.77

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.16
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.34
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.63
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 247 4.8% 14.1 21.72sec 5250 0 Direct 14.1 2158 6082 5252 78.8%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 0.00 0.00 0.0000 0.0000 73994.16 73994.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.20% 2.99 0 7 2158.29 1757 3460 2110.54 0 3203 6449 6449 0.00%
crit 78.80% 11.11 6 16 6081.80 3514 6919 6087.84 5368 6515 67545 67545 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2079 (2212) 40.4% (43.0%) 96.5 3.10sec 6876 6153 Direct 97.2 (274.9) 3151 7885 6417 69.0% (69.0%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.49 97.19 0.00 0.00 1.1174 0.0000 623572.64 623572.64 0.00% 6153.40 6153.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.03% 30.16 15 47 3150.67 2624 5239 3150.01 2901 3485 95015 95015 0.00%
crit 68.97% 67.03 38 117 7885.24 5249 10479 7908.70 7190 8771 528557 528557 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:6.97
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.38
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.29
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.91
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.35
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.41
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.69
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.48
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.23
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.81
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 133 2.6% 97.2 3.10sec 410 0 Periodic 177.7 139 354 224 39.6% 86.5%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.19 0.00 177.71 177.71 0.0000 1.4623 39887.08 39887.08 0.00% 153.49 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.39% 107.31 73 147 139.18 5 238 139.18 130 148 14937 14937 0.00%
crit 39.61% 70.40 48 98 354.42 10 477 354.89 331 384 24950 24950 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 216 4.2% 33.7 7.47sec 1931 1675 Direct 33.7 0 1932 1932 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.72 33.72 0.00 0.00 1.1530 0.0000 65125.74 65125.74 0.00% 1674.96 1674.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.72 17 53 1931.61 1174 3402 1932.03 1738 2164 65126 65126 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.73
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:8.04
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.31
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
mechagnome
Combustion 4.7 70.77sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.66
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mechagnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mechagnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.21
Rune of Power 5.3 60.79sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 0.00 0.00 0.00 1.1118 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.31
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combat Analysis 1.0 58.6 0.0sec 5.0sec 295.5sec 98.31% 0.00% 50.6 (50.6) 0.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_combat_analysis
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:intellect
  • amount:3.80

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:5.0s / 5.0s
  • trigger_pct:100.00%
  • duration_min/max:235.0s / 354.9s

Stack Uptimes

  • combat_analysis_1:1.69%
  • combat_analysis_3:1.69%
  • combat_analysis_4:1.69%
  • combat_analysis_5:1.69%
  • combat_analysis_6:1.69%
  • combat_analysis_7:1.69%
  • combat_analysis_8:1.69%
  • combat_analysis_9:1.69%
  • combat_analysis_10:84.82%

Spelldata

  • id:312923
  • name:Combat Analysis
  • tooltip:
  • description:You gather and analyze combat data every $t1 sec, increasing your primary stat by {$s1=4}, stacking up to {$s3=10} times. The data decays while out of combat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.8sec 70.8sec 11.8sec 18.37% 0.00% 105.6 (105.6) 4.5

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:49.7s / 88.4s
  • trigger_min/max:49.7s / 88.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.37%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.6 24.9 9.1sec 4.2sec 5.1sec 36.88% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 50.0s
  • trigger_min/max:1.3s / 38.9s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 32.4s

Stack Uptimes

  • fireball_1:20.60%
  • fireball_2:9.03%
  • fireball_3:4.40%
  • fireball_4:1.96%
  • fireball_5:0.69%
  • fireball_6:0.16%
  • fireball_7:0.03%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.8 36.6sec 32.6sec 4.2sec 10.96% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 171.6s
  • trigger_min/max:0.8s / 171.6s
  • trigger_pct:10.14%
  • duration_min/max:0.0s / 13.2s

Stack Uptimes

  • firestorm_1:10.96%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.2sec 72.9sec 14.7sec 22.87% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 88.4s
  • trigger_min/max:60.0s / 88.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.87%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.2 0.0 3.1sec 3.1sec 1.1sec 35.20% 46.72% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.2s
  • trigger_min/max:0.2s / 19.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • heating_up_1:35.20%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.3 0.0 3.6sec 3.6sec 0.6sec 12.99% 86.52% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 35.0s
  • trigger_min/max:0.5s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s

Stack Uptimes

  • hot_streak_1:12.99%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 307.3sec 0.0sec 23.5sec 9.48% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 358.7s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.48%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.2sec 11.9sec 38.85% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 73.5s
  • trigger_min/max:7.1s / 73.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s

Stack Uptimes

  • rune_of_power_1:38.85%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.2 72.0 126.0 3.1s 0.2s 19.2s
Heating Up removed 11.4 2.0 23.0 23.7s 0.8s 258.7s
Heating Up converted with Fire Blast 23.4 13.0 35.0 12.1s 0.5s 98.3s
Hot Streak procs 84.3 62.0 116.0 3.6s 0.5s 35.0s
Hot Streak spells used 264.7 212.0 320.0 1.1s 0.0s 5.1s
Hot Streak spell crits 185.1 142.0 244.0 1.6s 0.0s 18.5s
Hot Streak spell crits wasted 4.6 0.0 10.0 65.0s 0.1s 321.9s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.07% 9.72% 18.74% 0.5s 0.0s 4.2s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3250.00012.7720.9740.00012.772
Rune of Power14.0820.00039.43176.65517.822129.222
Fire Blast0.0960.00021.1354.0431.30026.041
Dragon's Breath135.48045.891310.863286.194190.281359.744
Combustion2.2341.30010.39910.4745.62021.217
Phoenix Flames0.2040.00027.3912.8881.73829.410

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
mechagnome
mana_regen Mana 2175.91 238403.51 100.00% 109.56 61743.25 20.57%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.37 798.14 61759.9 48566.5 42268.0 50000.0
Usage Type Count Total Avg RPE APR
mechagnome
combustion Mana 4.7 23309.3 5000.0 5003.4 0.0
dragons_breath Mana 0.8 1620.3 2000.0 2000.1 2.0
fire_blast Mana 42.3 21148.9 500.0 500.0 8.7
fireball Mana 77.4 77418.3 1000.0 1000.0 2.5
mirror_image Mana 3.0 1990.2 665.6 665.6 5.6
pyroblast Mana 97.5 97515.9 1000.0 1010.6 6.8
scorch Mana 33.7 16851.1 500.0 499.7 3.9

Statistics & Data Analysis

Fight Length
mechagnome Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
mechagnome Damage Per Second
Count 1717
Mean 5140.82
Minimum 4535.35
Maximum 5947.26
Spread ( max - min ) 1411.91
Range [ ( max - min ) / 2 * 100% ] 13.73%
Standard Deviation 206.2942
5th Percentile 4838.28
95th Percentile 5512.27
( 95th Percentile - 5th Percentile ) 673.98
Mean Distribution
Standard Deviation 4.9785
95.00% Confidence Interval ( 5131.06 - 5150.57 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6186
0.1 Scale Factor Error with Delta=300 364
0.05 Scale Factor Error with Delta=300 1454
0.01 Scale Factor Error with Delta=300 36330
Priority Target DPS
mechagnome Priority Target Damage Per Second
Count 1717
Mean 5140.82
Minimum 4535.35
Maximum 5947.26
Spread ( max - min ) 1411.91
Range [ ( max - min ) / 2 * 100% ] 13.73%
Standard Deviation 206.2942
5th Percentile 4838.28
95th Percentile 5512.27
( 95th Percentile - 5th Percentile ) 673.98
Mean Distribution
Standard Deviation 4.9785
95.00% Confidence Interval ( 5131.06 - 5150.57 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6186
0.1 Scale Factor Error with Delta=300 364
0.05 Scale Factor Error with Delta=300 1454
0.01 Scale Factor Error with Delta=300 36330
DPS(e)
mechagnome Damage Per Second (Effective)
Count 1717
Mean 5140.82
Minimum 4535.35
Maximum 5947.26
Spread ( max - min ) 1411.91
Range [ ( max - min ) / 2 * 100% ] 13.73%
Damage
mechagnome Damage
Count 1717
Mean 1531555.54
Minimum 1183718.97
Maximum 2054945.75
Spread ( max - min ) 871226.78
Range [ ( max - min ) / 2 * 100% ] 28.44%
DTPS
mechagnome Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
mechagnome Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
mechagnome Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
mechagnome Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
mechagnome Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
mechagnome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
mechagnomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
mechagnome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.31 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.21 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.66 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.73 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.66 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 6.97 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.38 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.29 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.16 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.69 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.73 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.81 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.91 pyroblast,if=buff.firestorm.react
g 9.35 pyroblast,if=buff.hot_streak.react
h 2.99 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.28 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.41 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.34 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 8.04 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.74 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.69 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.48 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.23 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.30 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.81 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.63 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.31 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 52.02 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUZUZbZbZUYYYYZUOgnnnnNnnnnhigwwpwrpwwwwwrpooowpwrpooowwwwcWUTbZUZbZUZdadaOnignlgnnnipwwwrpooowpwrpwpwwwrNpwwwwrpMoowwwcWUbTYYYUZUZbZdaOnignnnnnnrptwwwrpwwwwwwwrpwrpwwwwOhnignnnnignwwwcWUTbZbZUZdadaeUwpvvstvrNsvsvOrgfffMgmhkmmkvvrqvvsvvsrooovsvvrqqvvsvsvvsvvsvvscWUTZZUZUZbZbZdUZOgmmkhlgmmkmmrqvvsv

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask mechagnome 50000.0/50000: 100% mana
Pre precombat 1 food mechagnome 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, heating_up, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.741 combustion_phase b phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.636 combustion_phase Z pyroblast Fluffy_Pillow 44836.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.636 combustion_phase U fire_blast Fluffy_Pillow 43836.0/50000: 88% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase Z pyroblast Fluffy_Pillow 44231.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase U fire_blast Fluffy_Pillow 43231.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.425 combustion_phase Z pyroblast Fluffy_Pillow 43625.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.320 combustion_phase b phoenix_flames Fluffy_Pillow 43520.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, combat_analysis, gladiators_badge, potion_of_spectral_intellect
0:06.215 combustion_phase Z pyroblast Fluffy_Pillow 44415.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, combat_analysis, gladiators_badge, potion_of_spectral_intellect
0:07.109 combustion_phase b phoenix_flames Fluffy_Pillow 44309.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, combat_analysis, gladiators_badge, potion_of_spectral_intellect
0:08.001 combustion_phase Z pyroblast Fluffy_Pillow 45201.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, combat_analysis, gladiators_badge, potion_of_spectral_intellect
0:08.001 combustion_phase U fire_blast Fluffy_Pillow 44201.0/50000: 88% mana bloodlust, combustion, rune_of_power, firestorm, combat_analysis, gladiators_badge, potion_of_spectral_intellect
0:08.895 combustion_phase Y pyroblast Fluffy_Pillow 44595.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, combat_analysis, gladiators_badge, potion_of_spectral_intellect
0:09.790 combustion_phase Y pyroblast Fluffy_Pillow 44490.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, combat_analysis, gladiators_badge, potion_of_spectral_intellect
0:10.687 combustion_phase Y pyroblast Fluffy_Pillow 44387.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, combat_analysis(3), gladiators_badge, potion_of_spectral_intellect
0:11.580 combustion_phase Y pyroblast Fluffy_Pillow 44280.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, combat_analysis(3), gladiators_badge, potion_of_spectral_intellect
0:12.475 combustion_phase Z pyroblast Fluffy_Pillow 44175.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, combat_analysis(3), gladiators_badge, potion_of_spectral_intellect
0:13.275 combustion_phase U fire_blast Fluffy_Pillow 43975.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, combat_analysis(3), gladiators_badge, potion_of_spectral_intellect
0:13.370 default O rune_of_power Fluffy_Pillow 43570.0/50000: 87% mana bloodlust, hot_streak, combat_analysis(3), gladiators_badge, potion_of_spectral_intellect
0:14.266 rop_phase g pyroblast Fluffy_Pillow 44466.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, combat_analysis(3), gladiators_badge, potion_of_spectral_intellect
0:15.160 rop_phase n fireball Fluffy_Pillow 44360.0/50000: 89% mana bloodlust, heating_up, rune_of_power, combat_analysis(4), potion_of_spectral_intellect
0:16.501 rop_phase n fireball Fluffy_Pillow 44701.0/50000: 89% mana bloodlust, heating_up, rune_of_power, combat_analysis(4), potion_of_spectral_intellect
0:17.844 rop_phase n fireball Fluffy_Pillow 45044.0/50000: 90% mana bloodlust, fireball, rune_of_power, combat_analysis(4), potion_of_spectral_intellect
0:19.183 rop_phase n fireball Fluffy_Pillow 45383.0/50000: 91% mana bloodlust, fireball(2), rune_of_power, combat_analysis(4), potion_of_spectral_intellect
0:20.523 default N use_item_dreadfire_vessel Fluffy_Pillow 45723.0/50000: 91% mana bloodlust, fireball(3), rune_of_power, combat_analysis(5), potion_of_spectral_intellect
0:20.523 rop_phase n fireball Fluffy_Pillow 45723.0/50000: 91% mana bloodlust, fireball(3), rune_of_power, combat_analysis(5), potion_of_spectral_intellect
0:21.863 rop_phase n fireball Fluffy_Pillow 46063.0/50000: 92% mana bloodlust, fireball(4), rune_of_power, combat_analysis(5), potion_of_spectral_intellect
0:23.204 rop_phase n fireball Fluffy_Pillow 46404.0/50000: 93% mana bloodlust, fireball(5), rune_of_power, combat_analysis(5), potion_of_spectral_intellect
0:24.545 rop_phase n fireball Fluffy_Pillow 46745.0/50000: 93% mana bloodlust, heating_up, rune_of_power, combat_analysis(5), potion_of_spectral_intellect
0:25.245 rop_phase h fire_blast Fluffy_Pillow 47445.0/50000: 95% mana bloodlust, fireball, rune_of_power, combat_analysis(6)
0:25.745 rop_phase i fire_blast Fluffy_Pillow 47445.0/50000: 95% mana bloodlust, fireball, heating_up, rune_of_power, combat_analysis(6)
0:25.886 rop_phase g pyroblast Fluffy_Pillow 46086.0/50000: 92% mana bloodlust, fireball, hot_streak, rune_of_power, combat_analysis(6)
0:26.782 standard_rotation w fireball Fluffy_Pillow 45982.0/50000: 92% mana bloodlust, fireball(2), heating_up, combat_analysis(6)
0:28.124 standard_rotation w fireball Fluffy_Pillow 46324.0/50000: 93% mana bloodlust, fireball(2), heating_up, combat_analysis(6)
0:29.464 standard_rotation p pyroblast Fluffy_Pillow 46664.0/50000: 93% mana bloodlust, hot_streak, combat_analysis(6)
0:30.358 standard_rotation w fireball Fluffy_Pillow 46558.0/50000: 93% mana bloodlust, heating_up, combat_analysis(7)
0:31.258 standard_rotation r fire_blast Fluffy_Pillow 47458.0/50000: 95% mana bloodlust, heating_up, combat_analysis(7)
0:31.697 standard_rotation p pyroblast Fluffy_Pillow 46397.0/50000: 93% mana bloodlust, hot_streak, combat_analysis(7)
0:32.591 standard_rotation w fireball Fluffy_Pillow 46291.0/50000: 93% mana bloodlust, fireball, combat_analysis(7)
0:33.933 standard_rotation w fireball Fluffy_Pillow 46633.0/50000: 93% mana bloodlust, fireball, combat_analysis(7)
0:35.274 standard_rotation w fireball Fluffy_Pillow 46974.0/50000: 94% mana bloodlust, fireball(2), combat_analysis(8)
0:36.613 standard_rotation w fireball Fluffy_Pillow 47313.0/50000: 95% mana bloodlust, heating_up, combat_analysis(8)
0:37.953 standard_rotation w fireball Fluffy_Pillow 47653.0/50000: 95% mana bloodlust, fireball, combat_analysis(8)
0:39.253 standard_rotation r fire_blast Fluffy_Pillow 48953.0/50000: 98% mana bloodlust, heating_up, combat_analysis(8)
0:39.294 standard_rotation p pyroblast Fluffy_Pillow 47494.0/50000: 95% mana bloodlust, hot_streak, firestorm, combat_analysis(8)
0:40.187 standard_rotation o pyroblast Fluffy_Pillow 47387.0/50000: 95% mana bloodlust, fireball, heating_up, firestorm, combat_analysis(9)
0:41.082 standard_rotation o pyroblast Fluffy_Pillow 47282.0/50000: 95% mana fireball, hot_streak, firestorm, combat_analysis(9)
0:42.243 standard_rotation o pyroblast Fluffy_Pillow 47443.0/50000: 95% mana fireball, heating_up, firestorm, combat_analysis(9)
0:43.405 standard_rotation w fireball Fluffy_Pillow 47605.0/50000: 95% mana fireball, hot_streak, combat_analysis(9)
0:45.147 standard_rotation p pyroblast Fluffy_Pillow 48347.0/50000: 97% mana fireball, hot_streak, combat_analysis(10)
0:46.308 standard_rotation w fireball Fluffy_Pillow 48508.0/50000: 97% mana heating_up, combat_analysis(10)
0:47.608 standard_rotation r fire_blast Fluffy_Pillow 49808.0/50000: 100% mana heating_up, combat_analysis(10)
0:48.051 standard_rotation p pyroblast Fluffy_Pillow 48751.0/50000: 98% mana hot_streak, firestorm, combat_analysis(10)
0:49.211 standard_rotation o pyroblast Fluffy_Pillow 48911.0/50000: 98% mana hot_streak, firestorm, combat_analysis(10)
0:50.374 standard_rotation o pyroblast Fluffy_Pillow 49074.0/50000: 98% mana heating_up, firestorm, combat_analysis(10)
0:51.535 standard_rotation o pyroblast Fluffy_Pillow 49235.0/50000: 98% mana hot_streak, firestorm, combat_analysis(10)
0:52.699 standard_rotation w fireball Fluffy_Pillow 49399.0/50000: 99% mana heating_up, combat_analysis(10)
0:54.440 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, combat_analysis(10)
0:56.182 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, combat_analysis(10)
0:57.923 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, combat_analysis(10)
0:59.665 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, combat_analysis(10)
1:00.965 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), combat_analysis(10)
1:00.965 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power, combat_analysis(10)
1:01.405 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, combat_analysis(10)
1:01.405 combustion_phase b phoenix_flames Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:02.568 combustion_phase Z pyroblast Fluffy_Pillow 45103.0/50000: 90% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
1:02.568 combustion_phase U fire_blast Fluffy_Pillow 44103.0/50000: 88% mana combustion, rune_of_power, combat_analysis(10), gladiators_badge
1:03.732 combustion_phase Z pyroblast Fluffy_Pillow 44767.0/50000: 90% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
1:04.893 combustion_phase b phoenix_flames Fluffy_Pillow 44928.0/50000: 90% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:06.055 combustion_phase Z pyroblast Fluffy_Pillow 46090.0/50000: 92% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
1:06.655 combustion_phase U fire_blast Fluffy_Pillow 45690.0/50000: 91% mana combustion, rune_of_power, combat_analysis(10), gladiators_badge
1:07.218 combustion_phase Z pyroblast Fluffy_Pillow 45753.0/50000: 92% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
1:08.381 combustion_phase d scorch Fluffy_Pillow 45916.0/50000: 92% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:09.543 combustion_phase a pyroblast Fluffy_Pillow 46578.0/50000: 93% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:10.717 combustion_phase d scorch Fluffy_Pillow 46752.0/50000: 94% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:11.879 combustion_phase a pyroblast Fluffy_Pillow 47414.0/50000: 95% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:13.053 default O rune_of_power Fluffy_Pillow 47588.0/50000: 95% mana heating_up, combat_analysis(10), gladiators_badge
1:14.217 rop_phase n fireball Fluffy_Pillow 48752.0/50000: 98% mana heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:15.517 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power, combat_analysis(10), gladiators_badge
1:15.959 rop_phase g pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
1:17.120 rop_phase n fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball, heating_up, rune_of_power, combat_analysis(10)
1:18.864 rop_phase l phoenix_flames Fluffy_Pillow 49007.0/50000: 98% mana fireball, heating_up, rune_of_power, combat_analysis(10)
1:20.027 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), hot_streak, rune_of_power, combat_analysis(10)
1:21.190 rop_phase n fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), rune_of_power, combat_analysis(10)
1:22.931 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power, combat_analysis(10)
1:24.672 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3), rune_of_power, combat_analysis(10)
1:25.972 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power, combat_analysis(10)
1:26.413 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, combat_analysis(10)
1:27.576 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball, combat_analysis(10)
1:29.317 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, combat_analysis(10)
1:31.058 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), combat_analysis(10)
1:32.358 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
1:32.799 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, firestorm, combat_analysis(10)
1:33.961 standard_rotation o pyroblast Fluffy_Pillow 49103.0/50000: 98% mana fireball, heating_up, firestorm, combat_analysis(10)
1:35.123 standard_rotation o pyroblast Fluffy_Pillow 49265.0/50000: 99% mana fireball, hot_streak, firestorm, combat_analysis(10)
1:36.286 standard_rotation o pyroblast Fluffy_Pillow 49428.0/50000: 99% mana fireball, heating_up, firestorm, combat_analysis(10)
1:37.447 standard_rotation w fireball Fluffy_Pillow 49589.0/50000: 99% mana fireball, hot_streak, combat_analysis(10)
1:39.190 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana fireball, hot_streak, combat_analysis(10)
1:40.354 standard_rotation w fireball Fluffy_Pillow 49170.0/50000: 98% mana fireball(2), heating_up, combat_analysis(10)
1:41.654 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), heating_up, combat_analysis(10)
1:42.096 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana fireball(2), hot_streak, combat_analysis(10)
1:43.259 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana hot_streak, combat_analysis(10)
1:45.002 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak, combat_analysis(10)
1:46.165 standard_rotation w fireball Fluffy_Pillow 49169.0/50000: 98% mana fireball, combat_analysis(10)
1:47.908 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, combat_analysis(10)
1:49.648 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2), combat_analysis(10)
1:50.948 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
1:51.389 default N use_item_dreadfire_vessel Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, combat_analysis(10)
1:51.389 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, combat_analysis(10)
1:52.552 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball, combat_analysis(10)
1:54.294 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, combat_analysis(10)
1:56.035 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), combat_analysis(10)
1:57.777 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), combat_analysis(10)
1:59.277 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
1:59.517 standard_rotation p pyroblast Fluffy_Pillow 48740.0/50000: 97% mana hot_streak, firestorm, combat_analysis(10)
2:00.682 default M mirror_image Fluffy_Pillow 48905.0/50000: 98% mana fireball, heating_up, firestorm, combat_analysis(10)
2:01.845 standard_rotation o pyroblast Fluffy_Pillow 49068.0/50000: 98% mana fireball, heating_up, firestorm, combat_analysis(10)
2:03.008 standard_rotation o pyroblast Fluffy_Pillow 49231.0/50000: 98% mana fireball, hot_streak, firestorm, combat_analysis(10)
2:04.172 standard_rotation w fireball Fluffy_Pillow 49395.0/50000: 99% mana fireball, heating_up, combat_analysis(10)
2:05.915 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, heating_up, combat_analysis(10)
2:07.656 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), combat_analysis(10)
2:09.398 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up, combat_analysis(10)
2:10.698 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, combat_analysis(10)
2:10.698 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power, combat_analysis(10)
2:11.139 combustion_phase b phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, combat_analysis(10)
2:11.439 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44241.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, combat_analysis(10)
2:12.301 combustion_phase Y pyroblast Fluffy_Pillow 45103.0/50000: 90% mana combustion, hot_streak, rune_of_power, firestorm, combat_analysis(10), gladiators_badge
2:13.464 combustion_phase Y pyroblast Fluffy_Pillow 45266.0/50000: 91% mana combustion, heating_up, rune_of_power, firestorm, combat_analysis(10), gladiators_badge
2:14.625 combustion_phase Y pyroblast Fluffy_Pillow 45427.0/50000: 91% mana combustion, hot_streak, rune_of_power, firestorm, combat_analysis(10), gladiators_badge
2:15.789 combustion_phase U fire_blast Fluffy_Pillow 45591.0/50000: 91% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
2:15.789 combustion_phase Z pyroblast Fluffy_Pillow 45091.0/50000: 90% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
2:16.289 combustion_phase U fire_blast Fluffy_Pillow 44591.0/50000: 89% mana combustion, rune_of_power, combat_analysis(10), gladiators_badge
2:16.953 combustion_phase Z pyroblast Fluffy_Pillow 44755.0/50000: 90% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
2:18.116 combustion_phase b phoenix_flames Fluffy_Pillow 44918.0/50000: 90% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
2:19.278 combustion_phase Z pyroblast Fluffy_Pillow 46080.0/50000: 92% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
2:20.441 combustion_phase d scorch Fluffy_Pillow 46243.0/50000: 92% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
2:21.606 combustion_phase a pyroblast Fluffy_Pillow 46908.0/50000: 94% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
2:22.777 default O rune_of_power Fluffy_Pillow 47079.0/50000: 94% mana heating_up, combat_analysis(10), gladiators_badge
2:23.939 rop_phase n fireball Fluffy_Pillow 48241.0/50000: 96% mana heating_up, rune_of_power, combat_analysis(10), gladiators_badge
2:25.239 rop_phase i fire_blast Fluffy_Pillow 49541.0/50000: 99% mana heating_up, rune_of_power, combat_analysis(10), gladiators_badge
2:25.680 rop_phase g pyroblast Fluffy_Pillow 48482.0/50000: 97% mana hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
2:26.841 rop_phase n fireball Fluffy_Pillow 48643.0/50000: 97% mana fireball, rune_of_power, combat_analysis(10)
2:28.582 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power, combat_analysis(10)
2:30.323 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, rune_of_power, combat_analysis(10)
2:32.066 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, rune_of_power, combat_analysis(10)
2:33.807 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power, combat_analysis(10)
2:35.548 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3), rune_of_power, combat_analysis(10)
2:36.948 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
2:37.290 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak, combat_analysis(10)
2:38.453 standard_rotation t phoenix_flames Fluffy_Pillow 49005.0/50000: 98% mana fireball, combat_analysis(10)
2:39.616 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball, combat_analysis(10)
2:41.357 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, combat_analysis(10)
2:43.099 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), combat_analysis(10)
2:44.399 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
2:44.841 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, combat_analysis(10)
2:46.004 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball, combat_analysis(10)
2:47.744 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball, combat_analysis(10)
2:49.484 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2), combat_analysis(10)
2:51.226 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), combat_analysis(10)
2:52.968 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4), combat_analysis(10)
2:54.710 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(5), combat_analysis(10)
2:56.453 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(6), combat_analysis(10)
2:58.153 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
2:58.193 standard_rotation p pyroblast Fluffy_Pillow 48540.0/50000: 97% mana hot_streak, combat_analysis(10)
2:59.354 standard_rotation w fireball Fluffy_Pillow 48701.0/50000: 97% mana heating_up, combat_analysis(10)
3:00.654 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
3:01.095 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak, combat_analysis(10)
3:02.257 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball, combat_analysis(10)
3:04.000 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, combat_analysis(10)
3:05.741 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), combat_analysis(10)
3:07.482 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3), combat_analysis(10)
3:09.225 default O rune_of_power Fluffy_Pillow 49006.0/50000: 98% mana fireball(4), combat_analysis(10)
3:10.387 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(5), rune_of_power, combat_analysis(10)
3:10.387 rop_phase n fireball Fluffy_Pillow 49500.0/50000: 99% mana fireball(5), heating_up, rune_of_power, combat_analysis(10)
3:11.687 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(5), heating_up, rune_of_power, combat_analysis(10)
3:12.130 rop_phase g pyroblast Fluffy_Pillow 48943.0/50000: 98% mana fireball(5), hot_streak, rune_of_power, combat_analysis(10)
3:13.292 rop_phase n fireball Fluffy_Pillow 49105.0/50000: 98% mana heating_up, rune_of_power, combat_analysis(10)
3:15.033 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, rune_of_power, combat_analysis(10)
3:16.774 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power, combat_analysis(10)
3:18.517 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2), rune_of_power, combat_analysis(10)
3:19.917 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power, combat_analysis(10)
3:20.258 rop_phase g pyroblast Fluffy_Pillow 48841.0/50000: 98% mana hot_streak, rune_of_power, combat_analysis(10)
3:21.421 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, heating_up, rune_of_power, combat_analysis(10)
3:23.163 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, heating_up, combat_analysis(10)
3:24.907 standard_rotation w fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball(2), combat_analysis(10)
3:26.649 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), combat_analysis(10)
3:28.391 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up, combat_analysis(10)
3:29.691 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, combat_analysis(10)
3:29.691 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power, combat_analysis(10)
3:30.131 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, combat_analysis(10)
3:30.131 combustion_phase b phoenix_flames Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:31.294 combustion_phase Z pyroblast Fluffy_Pillow 45103.0/50000: 90% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
3:32.456 combustion_phase b phoenix_flames Fluffy_Pillow 45265.0/50000: 91% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:33.620 combustion_phase Z pyroblast Fluffy_Pillow 46429.0/50000: 93% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
3:33.620 combustion_phase U fire_blast Fluffy_Pillow 45429.0/50000: 91% mana combustion, rune_of_power, combat_analysis(10), gladiators_badge
3:34.785 combustion_phase Z pyroblast Fluffy_Pillow 46094.0/50000: 92% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
3:35.946 combustion_phase d scorch Fluffy_Pillow 46255.0/50000: 93% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:37.108 combustion_phase a pyroblast Fluffy_Pillow 46917.0/50000: 94% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:38.280 combustion_phase d scorch Fluffy_Pillow 47089.0/50000: 94% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:39.443 combustion_phase a pyroblast Fluffy_Pillow 47752.0/50000: 96% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:40.616 combustion_phase e dragons_breath Fluffy_Pillow 47925.0/50000: 96% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:41.116 combustion_phase U fire_blast Fluffy_Pillow 46425.0/50000: 93% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
3:41.777 standard_rotation w fireball Fluffy_Pillow 46586.0/50000: 93% mana hot_streak, combat_analysis(10), gladiators_badge
3:43.519 standard_rotation p pyroblast Fluffy_Pillow 47328.0/50000: 95% mana hot_streak, combat_analysis(10), gladiators_badge
3:44.682 standard_rotation v scorch Fluffy_Pillow 47491.0/50000: 95% mana fireball, combat_analysis(10), gladiators_badge
3:45.845 standard_rotation v scorch Fluffy_Pillow 48154.0/50000: 96% mana fireball, combat_analysis(10)
3:47.007 standard_rotation s pyroblast Fluffy_Pillow 48816.0/50000: 98% mana fireball, heating_up, combat_analysis(10)
3:48.182 standard_rotation t phoenix_flames Fluffy_Pillow 48991.0/50000: 98% mana fireball, combat_analysis(10)
3:49.345 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana fireball, combat_analysis(10)
3:49.345 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, combat_analysis(10)
3:50.509 default N use_item_dreadfire_vessel Fluffy_Pillow 49506.0/50000: 99% mana fireball, heating_up, combat_analysis(10)
3:50.509 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana fireball, heating_up, combat_analysis(10)
3:51.681 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana fireball, heating_up, combat_analysis(10)
3:52.844 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana fireball, heating_up, combat_analysis(10)
3:54.018 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana fireball, combat_analysis(10)
3:55.179 default O rune_of_power Fluffy_Pillow 49503.0/50000: 99% mana fireball, combat_analysis(10)
3:56.460 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up, combat_analysis(10)
3:56.546 rop_phase g pyroblast Fluffy_Pillow 49586.0/50000: 99% mana fireball, hot_streak, rune_of_power, firestorm, combat_analysis(10)
3:57.708 rop_phase f pyroblast Fluffy_Pillow 49748.0/50000: 99% mana fireball, heating_up, rune_of_power, firestorm, combat_analysis(10)
3:58.872 rop_phase f pyroblast Fluffy_Pillow 49912.0/50000: 100% mana fireball, hot_streak, rune_of_power, firestorm, combat_analysis(10)
4:00.034 rop_phase f pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power, firestorm, combat_analysis(10)
4:01.196 default M mirror_image Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power, combat_analysis(10)
4:02.358 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power, combat_analysis(10)
4:03.520 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power, combat_analysis(10)
4:04.181 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power, combat_analysis(10)
4:04.680 rop_phase k pyroblast Fluffy_Pillow 49499.0/50000: 99% mana heating_up, rune_of_power, combat_analysis(10)
4:05.857 rop_phase m scorch Fluffy_Pillow 49676.0/50000: 99% mana rune_of_power, combat_analysis(10)
4:07.021 rop_phase m scorch Fluffy_Pillow 49506.0/50000: 99% mana rune_of_power, combat_analysis(10)
4:08.183 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power, combat_analysis(10)
4:09.357 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana combat_analysis(10)
4:10.520 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana combat_analysis(10)
4:11.683 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, combat_analysis(10)
4:11.902 standard_rotation q pyroblast Fluffy_Pillow 49224.0/50000: 98% mana hot_streak, combat_analysis(10)
4:13.064 standard_rotation v scorch Fluffy_Pillow 49386.0/50000: 99% mana combat_analysis(10)
4:14.228 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana combat_analysis(10)
4:15.391 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, combat_analysis(10)
4:16.562 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana combat_analysis(10)
4:17.725 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana combat_analysis(10)
4:18.887 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, combat_analysis(10)
4:19.698 standard_rotation r fire_blast Fluffy_Pillow 49315.0/50000: 99% mana heating_up, firestorm, combat_analysis(10)
4:20.060 standard_rotation o pyroblast Fluffy_Pillow 49177.0/50000: 98% mana hot_streak, firestorm, combat_analysis(10)
4:21.221 standard_rotation o pyroblast Fluffy_Pillow 49338.0/50000: 99% mana heating_up, firestorm, combat_analysis(10)
4:22.383 standard_rotation o pyroblast Fluffy_Pillow 49500.0/50000: 99% mana hot_streak, firestorm, combat_analysis(10)
4:23.544 standard_rotation v scorch Fluffy_Pillow 49661.0/50000: 99% mana heating_up, combat_analysis(10)
4:24.705 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, combat_analysis(10)
4:25.880 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana combat_analysis(10)
4:27.042 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana combat_analysis(10)
4:28.205 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, combat_analysis(10)
4:28.205 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak, combat_analysis(10)
4:29.366 standard_rotation q pyroblast Fluffy_Pillow 49166.0/50000: 98% mana hot_streak, combat_analysis(10)
4:30.527 standard_rotation v scorch Fluffy_Pillow 49327.0/50000: 99% mana combat_analysis(10)
4:31.690 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana combat_analysis(10)
4:32.853 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, combat_analysis(10)
4:34.026 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, combat_analysis(10)
4:35.189 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, combat_analysis(10)
4:36.361 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana combat_analysis(10)
4:37.523 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana combat_analysis(10)
4:38.685 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, combat_analysis(10)
4:39.859 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana combat_analysis(10)
4:41.022 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana combat_analysis(10)
4:42.186 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, combat_analysis(10)
4:43.355 standard_rotation v scorch Fluffy_Pillow 49675.0/50000: 99% mana combat_analysis(10)
4:44.518 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana combat_analysis(10)
4:45.682 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, combat_analysis(10)
4:46.852 combustion_phase c fireball Fluffy_Pillow 49676.0/50000: 99% mana heating_up, combat_analysis(10)
4:48.152 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up, combat_analysis(10)
4:48.152 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power, combat_analysis(10)
4:48.595 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43943.0/50000: 88% mana combustion, hot_streak, rune_of_power, combat_analysis(10)
4:48.595 combustion_phase Z pyroblast Fluffy_Pillow 43943.0/50000: 88% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
4:49.757 combustion_phase Z pyroblast Fluffy_Pillow 44105.0/50000: 88% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
4:49.757 combustion_phase U fire_blast Fluffy_Pillow 43105.0/50000: 86% mana combustion, rune_of_power, combat_analysis(10), gladiators_badge
4:50.920 combustion_phase Z pyroblast Fluffy_Pillow 43768.0/50000: 88% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
4:50.920 combustion_phase U fire_blast Fluffy_Pillow 42768.0/50000: 86% mana combustion, rune_of_power, combat_analysis(10), gladiators_badge
4:52.081 combustion_phase Z pyroblast Fluffy_Pillow 43429.0/50000: 87% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
4:53.245 combustion_phase b phoenix_flames Fluffy_Pillow 43593.0/50000: 87% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
4:54.408 combustion_phase Z pyroblast Fluffy_Pillow 44756.0/50000: 90% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
4:55.569 combustion_phase b phoenix_flames Fluffy_Pillow 44917.0/50000: 90% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
4:56.732 combustion_phase Z pyroblast Fluffy_Pillow 46080.0/50000: 92% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
4:57.895 combustion_phase d scorch Fluffy_Pillow 46243.0/50000: 92% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
4:58.295 combustion_phase U fire_blast Fluffy_Pillow 46643.0/50000: 93% mana combustion, heating_up, rune_of_power, combat_analysis(10), gladiators_badge
4:59.059 combustion_phase Z pyroblast Fluffy_Pillow 46407.0/50000: 93% mana combustion, hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
5:00.223 default O rune_of_power Fluffy_Pillow 46571.0/50000: 93% mana hot_streak, combat_analysis(10), gladiators_badge
5:01.383 rop_phase g pyroblast Fluffy_Pillow 47731.0/50000: 95% mana hot_streak, rune_of_power, combat_analysis(10), gladiators_badge
5:02.545 rop_phase m scorch Fluffy_Pillow 47893.0/50000: 96% mana rune_of_power, combat_analysis(10), gladiators_badge
5:03.709 rop_phase m scorch Fluffy_Pillow 48557.0/50000: 97% mana rune_of_power, combat_analysis(10)
5:04.871 rop_phase k pyroblast Fluffy_Pillow 49219.0/50000: 98% mana heating_up, rune_of_power, combat_analysis(10)
5:05.949 rop_phase h fire_blast Fluffy_Pillow 49230.0/50000: 98% mana rune_of_power, combat_analysis(10)
5:06.043 rop_phase l phoenix_flames Fluffy_Pillow 48891.0/50000: 98% mana heating_up, rune_of_power, combat_analysis(10)
5:07.205 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power, combat_analysis(10)
5:08.368 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power, combat_analysis(10)
5:09.531 rop_phase m scorch Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power, combat_analysis(10)
5:10.691 rop_phase k pyroblast Fluffy_Pillow 49502.0/50000: 99% mana heating_up, rune_of_power, combat_analysis(10)
5:11.868 rop_phase m scorch Fluffy_Pillow 49679.0/50000: 99% mana rune_of_power, combat_analysis(10)
5:13.030 rop_phase m scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power, combat_analysis(10)
5:14.193 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, combat_analysis(10)
5:14.193 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak, combat_analysis(10)
5:15.355 standard_rotation v scorch Fluffy_Pillow 49167.0/50000: 98% mana combat_analysis(10)
5:16.518 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana combat_analysis(10)
5:17.680 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, combat_analysis(10)
5:18.852 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana combat_analysis(10)

Stats

Level Bonus (60) Race Bonus (mechagnome) Raid-Buffed Unbuffed Gear Amount
Strength 198 -2 196 196 0
Agility 306 1 307 307 0
Stamina 414 -1 2017 1921 1508
Intellect 450 2 1819 1638 1108 (132)
Spirit 0 0 0 0 0
Health 40340 38420 0
Mana 50000 50000 0
Spell Power 1819 1638 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="mechagnome"
source=default
spec=fire
level=60
race=mechagnome
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

night_elf : 5079 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5078.7 5078.7 9.7 / 0.191% 805.3 / 15.9% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
799.8 795.1 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
night_elf 5079
Conflagration Flare Up 24 0.5% 29.9 9.82sec 238 0 Direct 29.9 150 373 238 39.5%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.87 29.87 0.00 0.00 0.0000 0.0000 7110.19 7110.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.52% 18.08 5 36 149.81 130 255 149.91 132 174 2709 2709 0.00%
crit 39.48% 11.79 2 23 373.16 260 510 373.17 277 468 4401 4401 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.9 113.02sec 3897 3355 Direct 0.9 0 3897 3897 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.86 0.86 0.00 0.00 1.1625 0.0000 3354.79 3354.79 0.00% 3354.79 3354.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.86 0 4 3897.36 3786 4398 2442.38 0 4398 3355 3355 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.86
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 161 3.2% 3.3 103.80sec 14637 0 Direct 3.3 11657 23308 14683 26.0%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.31 3.30 0.00 0.00 0.0000 0.0000 48386.90 48386.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.02% 2.44 0 4 11657.15 11342 12023 11478.38 0 12023 28433 28433 0.00%
crit 25.98% 0.86 0 4 23308.26 22685 24046 14746.35 0 24046 19954 19954 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 600 11.8% 42.3 7.14sec 4254 0 Direct 42.3 0 4254 4254 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.33 42.33 0.00 0.00 0.0000 0.0000 180055.38 180055.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.33 34 50 4253.87 3045 5979 4255.65 4005 4472 180055 180055 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.81
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:2.95
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.24
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.33
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 612 (640) 12.1% (12.6%) 77.0 3.42sec 2496 1501 Direct 77.0 (220.3) 1653 3448 2386 40.8% (40.8%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.00 77.00 0.00 0.00 1.6628 0.0000 183705.84 183705.84 0.00% 1500.86 1500.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.15% 45.55 27 67 1652.61 1437 2575 1653.05 1517 1780 75275 75275 0.00%
crit 40.85% 31.45 18 46 3447.63 2874 5643 3450.93 3243 3766 108431 108431 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.70
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.63
    standard_rotation
    [w]:51.73
    Conflagration 28 0.6% 77.0 3.41sec 110 0 Periodic 143.3 35 90 59 43.7% 69.0%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.00 0.00 143.28 143.28 0.0000 1.4471 8472.16 8472.16 0.00% 40.86 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 56.31% 80.69 54 112 35.47 0 57 35.47 34 39 2862 2862 0.00%
crit 43.69% 62.59 42 87 89.63 0 125 89.70 83 98 5610 5610 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 961 18.9% 264.9 1.13sec 1089 0 Periodic 299.2 964 0 964 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.87 0.00 299.20 299.20 0.0000 1.0000 288434.79 288434.79 0.00% 964.01 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 963.91 152 2892 965.29 828 1151 288435 288435 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.42sec 3683 4759

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7740 0.0000 0.00 0.00 0.00% 4758.72 4758.72

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 33 Direct 235.3 37 75 47 25.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.00 235.26 0.00 0.00 1.3988 0.0000 11021.19 11021.19 0.00% 33.39 33.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.59% 175.47 117 206 37.35 29 53 37.43 35 41 6555 6555 0.00%
crit 25.41% 59.79 31 87 74.69 57 106 74.87 64 86 4466 4466 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.70
Phoenix Flames 0 (242) 0.0% (4.8%) 14.1 21.71sec 5139 4665

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.12 0.00 0.00 0.00 1.1018 0.0000 0.00 0.00 0.00% 4664.54 4664.54

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.10
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.35
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.67
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 242 4.8% 14.1 21.71sec 5149 0 Direct 14.1 2093 5979 5151 78.6%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 0.00 0.00 0.0000 0.0000 72580.29 72580.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.35% 3.01 0 9 2092.96 1730 3397 2065.08 0 3397 6300 6300 0.00%
crit 78.65% 11.09 4 16 5978.89 3460 6795 5985.08 5287 6455 66281 66281 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2061 (2192) 40.6% (43.2%) 97.3 3.08sec 6760 6050 Direct 98.0 (276.5) 3079 7739 6308 69.3% (69.3%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.31 98.03 0.00 0.00 1.1173 0.0000 618306.53 618306.53 0.00% 6050.10 6050.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 30.71% 30.10 15 47 3079.40 2620 5145 3079.64 2802 3385 92702 92702 0.00%
crit 69.29% 67.93 42 110 7738.67 5240 10290 7759.87 7027 8621 525604 525604 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.02
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.67
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.23
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.99
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.37
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.45
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.85
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.65
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.24
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.82
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.6% 98.0 3.07sec 403 0 Periodic 178.4 136 347 221 40.4% 86.9%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.03 0.00 178.42 178.42 0.0000 1.4627 39472.46 39472.46 0.00% 151.25 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.64% 106.42 69 150 136.10 5 234 136.13 128 144 14485 14485 0.00%
crit 40.36% 72.00 49 102 347.05 10 468 347.49 319 379 24987 24987 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 209 4.1% 33.4 7.83sec 1885 1634 Direct 33.4 0 1885 1885 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.45 33.44 0.00 0.00 1.1533 0.0000 63043.96 63043.96 0.00% 1634.24 1634.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.44 17 51 1885.16 1150 3341 1886.58 1684 2163 63044 63044 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.70
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:7.93
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.20
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
night_elf
Combustion 4.7 70.55sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.68 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.68
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:night_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:night_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.17
Rune of Power 5.3 61.33sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 0.00 0.00 0.00 1.1118 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.31
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.4sec 70.4sec 11.8sec 18.48% 0.00% 106.2 (106.2) 4.6

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:48.7s / 88.0s
  • trigger_min/max:48.7s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.48%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.5 24.0 9.1sec 4.3sec 5.0sec 36.23% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 51.6s
  • trigger_min/max:1.3s / 45.9s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 32.0s

Stack Uptimes

  • fireball_1:20.46%
  • fireball_2:8.86%
  • fireball_3:4.31%
  • fireball_4:1.82%
  • fireball_5:0.62%
  • fireball_6:0.15%
  • fireball_7:0.03%
  • fireball_8:0.02%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.9 36.5sec 32.4sec 4.2sec 11.04% 0.00% 0.9 (0.9) 7.7

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 155.5s
  • trigger_min/max:0.8s / 155.5s
  • trigger_pct:10.16%
  • duration_min/max:0.0s / 14.0s

Stack Uptimes

  • firestorm_1:11.04%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 70.9sec 72.5sec 14.8sec 23.01% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 88.0s
  • trigger_min/max:60.0s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:23.01%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.7 0.0 3.1sec 3.1sec 1.1sec 35.55% 46.75% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.2s
  • trigger_min/max:0.2s / 19.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.2s

Stack Uptimes

  • heating_up_1:35.55%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 85.0 0.0 3.5sec 3.5sec 0.6sec 13.19% 86.46% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 33.1s
  • trigger_min/max:0.5s / 33.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s

Stack Uptimes

  • hot_streak_1:13.19%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 310.8sec 0.0sec 23.7sec 9.26% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.26%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.7sec 31.1sec 11.9sec 38.89% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 73.4s
  • trigger_min/max:2.5s / 73.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s

Stack Uptimes

  • rune_of_power_1:38.89%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.7 73.0 126.0 3.1s 0.2s 19.2s
Heating Up removed 11.4 2.0 24.0 23.7s 1.0s 270.1s
Heating Up converted with Fire Blast 23.4 13.0 35.0 12.1s 0.5s 95.7s
Hot Streak procs 85.0 62.0 112.0 3.5s 0.5s 33.1s
Hot Streak spells used 264.9 210.0 320.0 1.1s 0.0s 5.1s
Hot Streak spell crits 186.2 141.0 240.0 1.6s 0.0s 16.8s
Hot Streak spell crits wasted 4.5 0.0 12.0 65.0s 0.0s 340.4s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 13.96% 8.82% 18.71% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3170.0009.8770.9490.00010.315
Rune of Power14.1800.00040.48277.12816.304129.328
Fire Blast0.0900.00022.0233.8051.30026.295
Dragon's Breath139.40643.741310.852285.391187.553359.850
Combustion2.2181.30011.68010.4565.61121.320
Phoenix Flames0.2050.00024.6342.9071.73828.734

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
night_elf
mana_regen Mana 2168.50 238915.25 100.00% 110.18 61223.61 20.40%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 795.13 799.78 61224.3 48601.3 42427.0 50000.0
Usage Type Count Total Avg RPE APR
night_elf
combustion Mana 4.7 23413.2 5000.0 5003.2 0.0
dragons_breath Mana 0.9 1716.1 2000.0 1993.6 2.0
fire_blast Mana 42.3 21165.0 500.0 500.0 8.5
fireball Mana 77.0 77036.9 1000.0 1000.4 2.5
mirror_image Mana 3.0 1992.5 665.8 665.8 5.5
pyroblast Mana 98.3 98294.3 1000.0 1010.1 6.7
scorch Mana 33.4 16711.2 500.0 499.6 3.8

Statistics & Data Analysis

Fight Length
night_elf Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
night_elf Damage Per Second
Count 1717
Mean 5078.66
Minimum 4475.97
Maximum 5979.79
Spread ( max - min ) 1503.82
Range [ ( max - min ) / 2 * 100% ] 14.81%
Standard Deviation 204.6420
5th Percentile 4761.40
95th Percentile 5434.57
( 95th Percentile - 5th Percentile ) 673.17
Mean Distribution
Standard Deviation 4.9387
95.00% Confidence Interval ( 5068.98 - 5088.34 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6238
0.1 Scale Factor Error with Delta=300 358
0.05 Scale Factor Error with Delta=300 1430
0.01 Scale Factor Error with Delta=300 35750
Priority Target DPS
night_elf Priority Target Damage Per Second
Count 1717
Mean 5078.66
Minimum 4475.97
Maximum 5979.79
Spread ( max - min ) 1503.82
Range [ ( max - min ) / 2 * 100% ] 14.81%
Standard Deviation 204.6420
5th Percentile 4761.40
95th Percentile 5434.57
( 95th Percentile - 5th Percentile ) 673.17
Mean Distribution
Standard Deviation 4.9387
95.00% Confidence Interval ( 5068.98 - 5088.34 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6238
0.1 Scale Factor Error with Delta=300 358
0.05 Scale Factor Error with Delta=300 1430
0.01 Scale Factor Error with Delta=300 35750
DPS(e)
night_elf Damage Per Second (Effective)
Count 1717
Mean 5078.66
Minimum 4475.97
Maximum 5979.79
Spread ( max - min ) 1503.82
Range [ ( max - min ) / 2 * 100% ] 14.81%
Damage
night_elf Damage
Count 1717
Mean 1512923.30
Minimum 1163439.50
Maximum 1986547.83
Spread ( max - min ) 823108.32
Range [ ( max - min ) / 2 * 100% ] 27.20%
DTPS
night_elf Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
night_elf Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
night_elf Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
night_elf Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
night_elf Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
night_elf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
night_elfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
night_elf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.31 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.17 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.68 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.81 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.68 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.02 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.67 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.23 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.10 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.70 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.70 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.86 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.99 pyroblast,if=buff.firestorm.react
g 9.37 pyroblast,if=buff.hot_streak.react
h 2.95 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.24 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.45 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.35 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 7.93 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.63 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.85 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.65 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.24 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.33 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.82 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.67 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.20 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.73 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUZUZbZYYYYUZbZUOffffgnNnnnnhnpwwwwwrpwwwrpwwwwwrpwrpooowwwwcWUTbZUZUZbZdaYYOlngnigngnigwwwwrpwrpwpwrpwwNwwwrpwwMwwwwwwwcWUTbZUZUZbZdaUZeOnngnnnnhigoootwwwrpwwwrpwwpwwwrpwrpwwwpwwwcWTZZUYYYUZYYYZUOgnnnhlNmmigmttvvsroooMvsvrsvvsvvrqvqvvsvrqvqvqvvsvvsvvsvvsvrscWUTbYYYUZbYYYYOfhghmgmmkmhkmktvvsvrsNvvs

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask night_elf 50000.0/50000: 100% mana
Pre precombat 1 food night_elf 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.742 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.636 combustion_phase Z pyroblast Fluffy_Pillow 44836.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.636 combustion_phase U fire_blast Fluffy_Pillow 43836.0/50000: 88% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase Z pyroblast Fluffy_Pillow 44231.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase U fire_blast Fluffy_Pillow 43231.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.425 combustion_phase Z pyroblast Fluffy_Pillow 43625.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.319 combustion_phase b phoenix_flames Fluffy_Pillow 43519.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.214 combustion_phase Z pyroblast Fluffy_Pillow 44414.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:07.109 combustion_phase Y pyroblast Fluffy_Pillow 44309.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:08.003 combustion_phase Y pyroblast Fluffy_Pillow 44203.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:08.898 combustion_phase Y pyroblast Fluffy_Pillow 44098.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:09.793 combustion_phase Y pyroblast Fluffy_Pillow 43993.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:09.993 combustion_phase U fire_blast Fluffy_Pillow 43193.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.689 combustion_phase Z pyroblast Fluffy_Pillow 43389.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.582 combustion_phase b phoenix_flames Fluffy_Pillow 43282.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.475 combustion_phase Z pyroblast Fluffy_Pillow 44175.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.275 combustion_phase U fire_blast Fluffy_Pillow 43975.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.371 default O rune_of_power Fluffy_Pillow 43571.0/50000: 87% mana bloodlust, hot_streak, firestorm, gladiators_badge, potion_of_spectral_intellect
0:14.264 rop_phase f pyroblast Fluffy_Pillow 44464.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:15.160 rop_phase f pyroblast Fluffy_Pillow 44360.0/50000: 89% mana bloodlust, heating_up, rune_of_power, firestorm, potion_of_spectral_intellect
0:16.054 rop_phase f pyroblast Fluffy_Pillow 44254.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, firestorm, potion_of_spectral_intellect
0:16.948 rop_phase f pyroblast Fluffy_Pillow 44148.0/50000: 88% mana bloodlust, heating_up, rune_of_power, firestorm, potion_of_spectral_intellect
0:17.842 rop_phase g pyroblast Fluffy_Pillow 44042.0/50000: 88% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:18.737 rop_phase n fireball Fluffy_Pillow 43937.0/50000: 88% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:20.078 default N use_item_dreadfire_vessel Fluffy_Pillow 44278.0/50000: 89% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:20.078 rop_phase n fireball Fluffy_Pillow 44278.0/50000: 89% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:21.418 rop_phase n fireball Fluffy_Pillow 44618.0/50000: 89% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:22.758 rop_phase n fireball Fluffy_Pillow 44958.0/50000: 90% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:24.101 rop_phase n fireball Fluffy_Pillow 45301.0/50000: 91% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:25.101 rop_phase h fire_blast Fluffy_Pillow 46301.0/50000: 93% mana bloodlust, fireball, rune_of_power
0:25.440 rop_phase n fireball Fluffy_Pillow 45140.0/50000: 90% mana bloodlust, fireball, heating_up, rune_of_power
0:26.780 standard_rotation p pyroblast Fluffy_Pillow 45480.0/50000: 91% mana bloodlust, hot_streak
0:27.674 standard_rotation w fireball Fluffy_Pillow 45374.0/50000: 91% mana bloodlust, fireball
0:29.015 standard_rotation w fireball Fluffy_Pillow 45715.0/50000: 91% mana bloodlust, fireball
0:30.356 standard_rotation w fireball Fluffy_Pillow 46056.0/50000: 92% mana bloodlust, fireball(2)
0:31.695 standard_rotation w fireball Fluffy_Pillow 46395.0/50000: 93% mana bloodlust, heating_up
0:33.037 standard_rotation w fireball Fluffy_Pillow 46737.0/50000: 93% mana bloodlust, fireball
0:34.237 standard_rotation r fire_blast Fluffy_Pillow 47937.0/50000: 96% mana bloodlust, heating_up
0:34.377 standard_rotation p pyroblast Fluffy_Pillow 46577.0/50000: 93% mana bloodlust, hot_streak
0:35.271 standard_rotation w fireball Fluffy_Pillow 46471.0/50000: 93% mana bloodlust, fireball
0:36.611 standard_rotation w fireball Fluffy_Pillow 46811.0/50000: 94% mana bloodlust, fireball
0:37.952 standard_rotation w fireball Fluffy_Pillow 47152.0/50000: 94% mana bloodlust, fireball(2)
0:39.252 standard_rotation r fire_blast Fluffy_Pillow 48452.0/50000: 97% mana bloodlust, heating_up
0:39.290 standard_rotation p pyroblast Fluffy_Pillow 46990.0/50000: 94% mana bloodlust, hot_streak
0:40.185 standard_rotation w fireball Fluffy_Pillow 46885.0/50000: 94% mana bloodlust, fireball
0:41.526 standard_rotation w fireball Fluffy_Pillow 47226.0/50000: 94% mana fireball
0:43.266 standard_rotation w fireball Fluffy_Pillow 47966.0/50000: 96% mana fireball(2)
0:45.008 standard_rotation w fireball Fluffy_Pillow 48708.0/50000: 97% mana fireball(3)
0:46.749 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
0:48.449 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:48.491 standard_rotation p pyroblast Fluffy_Pillow 48542.0/50000: 97% mana hot_streak
0:49.653 standard_rotation w fireball Fluffy_Pillow 48704.0/50000: 97% mana heating_up
0:50.953 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:51.396 standard_rotation p pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak, firestorm
0:52.557 standard_rotation o pyroblast Fluffy_Pillow 49104.0/50000: 98% mana hot_streak, firestorm
0:53.719 standard_rotation o pyroblast Fluffy_Pillow 49266.0/50000: 99% mana heating_up, firestorm
0:54.881 standard_rotation o pyroblast Fluffy_Pillow 49428.0/50000: 99% mana hot_streak, firestorm
0:56.042 standard_rotation w fireball Fluffy_Pillow 49589.0/50000: 99% mana heating_up
0:57.781 standard_rotation w fireball Fluffy_Pillow 49002.0/50000: 98% mana heating_up
0:59.522 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:01.264 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:03.004 combustion_phase c fireball Fluffy_Pillow 49003.0/50000: 98% mana heating_up
1:04.304 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball
1:04.304 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power
1:04.746 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power
1:04.746 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, gladiators_badge
1:05.910 combustion_phase Z pyroblast Fluffy_Pillow 45106.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:05.910 combustion_phase U fire_blast Fluffy_Pillow 44106.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
1:07.073 combustion_phase Z pyroblast Fluffy_Pillow 44769.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:07.073 combustion_phase U fire_blast Fluffy_Pillow 43769.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
1:08.235 combustion_phase Z pyroblast Fluffy_Pillow 44431.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:09.395 combustion_phase b phoenix_flames Fluffy_Pillow 44591.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
1:10.557 combustion_phase Z pyroblast Fluffy_Pillow 45753.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:11.720 combustion_phase d scorch Fluffy_Pillow 45916.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
1:12.881 combustion_phase a pyroblast Fluffy_Pillow 46577.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.056 combustion_phase Y pyroblast Fluffy_Pillow 46752.0/50000: 94% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
1:15.219 combustion_phase Y pyroblast Fluffy_Pillow 46915.0/50000: 94% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
1:16.381 default O rune_of_power Fluffy_Pillow 47077.0/50000: 94% mana heating_up, firestorm, gladiators_badge
1:17.544 rop_phase l phoenix_flames Fluffy_Pillow 48240.0/50000: 96% mana heating_up, rune_of_power, gladiators_badge
1:18.707 rop_phase n fireball Fluffy_Pillow 49403.0/50000: 99% mana hot_streak, rune_of_power, gladiators_badge
1:20.449 rop_phase g pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak, rune_of_power
1:21.611 rop_phase n fireball Fluffy_Pillow 49167.0/50000: 98% mana fireball, heating_up, rune_of_power
1:22.911 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up, rune_of_power
1:23.352 rop_phase g pyroblast Fluffy_Pillow 48941.0/50000: 98% mana fireball, hot_streak, rune_of_power
1:24.514 rop_phase n fireball Fluffy_Pillow 49103.0/50000: 98% mana hot_streak, rune_of_power
1:26.256 rop_phase g pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak, rune_of_power
1:27.418 rop_phase n fireball Fluffy_Pillow 49167.0/50000: 98% mana heating_up, rune_of_power
1:28.718 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
1:29.160 rop_phase g pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, rune_of_power
1:30.322 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
1:32.064 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:33.806 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:35.548 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
1:36.848 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:37.291 standard_rotation p pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak
1:38.452 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana heating_up
1:39.752 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:40.194 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
1:41.357 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana hot_streak
1:43.099 standard_rotation p pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
1:44.260 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana heating_up
1:45.560 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:46.004 standard_rotation p pyroblast Fluffy_Pillow 48944.0/50000: 98% mana hot_streak
1:47.167 standard_rotation w fireball Fluffy_Pillow 49107.0/50000: 98% mana heating_up
1:48.910 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up
1:50.652 default N use_item_dreadfire_vessel Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:50.652 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:52.394 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:54.136 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
1:55.636 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:55.877 standard_rotation p pyroblast Fluffy_Pillow 48741.0/50000: 97% mana hot_streak
1:57.039 standard_rotation w fireball Fluffy_Pillow 48903.0/50000: 98% mana fireball
1:58.780 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:00.522 default M mirror_image Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:01.685 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball
2:03.426 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:05.167 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:06.907 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
2:08.649 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:10.391 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
2:12.133 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:13.875 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:15.175 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2)
2:15.175 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power
2:15.615 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power
2:15.615 combustion_phase b phoenix_flames Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, gladiators_badge
2:16.780 combustion_phase Z pyroblast Fluffy_Pillow 45105.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:16.780 combustion_phase U fire_blast Fluffy_Pillow 44105.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:17.944 combustion_phase Z pyroblast Fluffy_Pillow 44769.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:17.944 combustion_phase U fire_blast Fluffy_Pillow 43769.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:19.105 combustion_phase Z pyroblast Fluffy_Pillow 44430.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:20.269 combustion_phase b phoenix_flames Fluffy_Pillow 44594.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
2:21.434 combustion_phase Z pyroblast Fluffy_Pillow 45759.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:22.598 combustion_phase d scorch Fluffy_Pillow 45923.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:23.762 combustion_phase a pyroblast Fluffy_Pillow 46587.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:23.871 combustion_phase U fire_blast Fluffy_Pillow 45696.0/50000: 91% mana combustion, rune_of_power, gladiators_badge
2:24.933 combustion_phase Z pyroblast Fluffy_Pillow 46258.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:26.094 combustion_phase e dragons_breath Fluffy_Pillow 46419.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:27.257 default O rune_of_power Fluffy_Pillow 45582.0/50000: 91% mana heating_up, gladiators_badge
2:28.422 rop_phase n fireball Fluffy_Pillow 46747.0/50000: 93% mana heating_up, rune_of_power, gladiators_badge
2:30.164 rop_phase n fireball Fluffy_Pillow 47489.0/50000: 95% mana heating_up, rune_of_power, gladiators_badge
2:31.907 rop_phase g pyroblast Fluffy_Pillow 48232.0/50000: 96% mana hot_streak, rune_of_power
2:33.068 rop_phase n fireball Fluffy_Pillow 48393.0/50000: 97% mana fireball, rune_of_power
2:34.810 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
2:36.554 rop_phase n fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball(2), rune_of_power
2:38.298 rop_phase n fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball(3), rune_of_power
2:39.298 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(4), rune_of_power
2:39.798 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(4), heating_up, rune_of_power
2:40.039 rop_phase g pyroblast Fluffy_Pillow 48741.0/50000: 97% mana fireball(4), hot_streak, rune_of_power, firestorm
2:41.199 standard_rotation o pyroblast Fluffy_Pillow 48901.0/50000: 98% mana hot_streak, firestorm
2:42.362 standard_rotation o pyroblast Fluffy_Pillow 49064.0/50000: 98% mana heating_up, firestorm
2:43.525 standard_rotation o pyroblast Fluffy_Pillow 49227.0/50000: 98% mana hot_streak, firestorm
2:44.687 standard_rotation t phoenix_flames Fluffy_Pillow 49389.0/50000: 99% mana heating_up
2:45.849 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana
2:47.590 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana
2:49.331 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:50.631 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:51.073 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:52.234 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
2:53.974 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
2:55.716 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:57.216 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:57.456 standard_rotation p pyroblast Fluffy_Pillow 48740.0/50000: 97% mana hot_streak
2:58.619 standard_rotation w fireball Fluffy_Pillow 48903.0/50000: 98% mana heating_up
3:00.361 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
3:02.104 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
3:03.268 standard_rotation w fireball Fluffy_Pillow 49170.0/50000: 98% mana fireball
3:05.010 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:06.753 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
3:08.053 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:08.494 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
3:09.656 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana heating_up
3:10.956 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:11.397 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
3:12.560 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
3:14.302 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:16.043 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:17.786 standard_rotation p pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
3:18.948 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball
3:20.691 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
3:22.430 standard_rotation w fireball Fluffy_Pillow 49002.0/50000: 98% mana heating_up
3:24.170 combustion_phase c fireball Fluffy_Pillow 49003.0/50000: 98% mana hot_streak
3:25.470 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
3:25.910 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44440.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power
3:25.910 combustion_phase Z pyroblast Fluffy_Pillow 44440.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, gladiators_badge
3:27.072 combustion_phase Z pyroblast Fluffy_Pillow 44602.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:27.072 combustion_phase U fire_blast Fluffy_Pillow 43602.0/50000: 87% mana combustion, rune_of_power, firestorm, gladiators_badge
3:28.234 combustion_phase Y pyroblast Fluffy_Pillow 44264.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:29.397 combustion_phase Y pyroblast Fluffy_Pillow 44427.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:30.559 combustion_phase Y pyroblast Fluffy_Pillow 44589.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:30.759 combustion_phase U fire_blast Fluffy_Pillow 43789.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
3:31.722 combustion_phase Z pyroblast Fluffy_Pillow 44252.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:32.883 combustion_phase Y pyroblast Fluffy_Pillow 44413.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:34.045 combustion_phase Y pyroblast Fluffy_Pillow 44575.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:35.205 combustion_phase Y pyroblast Fluffy_Pillow 44735.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:36.367 combustion_phase Z pyroblast Fluffy_Pillow 44897.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:36.367 combustion_phase U fire_blast Fluffy_Pillow 43897.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
3:37.528 default O rune_of_power Fluffy_Pillow 44558.0/50000: 89% mana hot_streak, gladiators_badge
3:38.691 rop_phase g pyroblast Fluffy_Pillow 45721.0/50000: 91% mana hot_streak, rune_of_power, gladiators_badge
3:39.854 rop_phase n fireball Fluffy_Pillow 45884.0/50000: 92% mana rune_of_power, gladiators_badge
3:41.596 rop_phase n fireball Fluffy_Pillow 46626.0/50000: 93% mana rune_of_power
3:43.338 rop_phase n fireball Fluffy_Pillow 47368.0/50000: 95% mana fireball, rune_of_power
3:43.938 rop_phase h fire_blast Fluffy_Pillow 47968.0/50000: 96% mana fireball, rune_of_power
3:45.081 rop_phase l phoenix_flames Fluffy_Pillow 47611.0/50000: 95% mana fireball(2), heating_up, rune_of_power
3:46.244 default N use_item_dreadfire_vessel Fluffy_Pillow 48774.0/50000: 98% mana fireball(3), rune_of_power
3:46.244 rop_phase m scorch Fluffy_Pillow 48774.0/50000: 98% mana fireball(3), rune_of_power
3:47.408 rop_phase m scorch Fluffy_Pillow 49438.0/50000: 99% mana fireball(3), rune_of_power
3:48.569 rop_phase i fire_blast Fluffy_Pillow 49503.0/50000: 99% mana fireball(3), heating_up, rune_of_power
3:48.739 rop_phase g pyroblast Fluffy_Pillow 49173.0/50000: 98% mana fireball(3), hot_streak, rune_of_power
3:49.901 rop_phase m scorch Fluffy_Pillow 49335.0/50000: 99% mana fireball(3), rune_of_power
3:51.064 standard_rotation t phoenix_flames Fluffy_Pillow 49505.0/50000: 99% mana fireball(3)
3:52.226 standard_rotation t phoenix_flames Fluffy_Pillow 50000.0/50000: 100% mana fireball(3)
3:53.389 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana fireball(3)
3:54.551 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana fireball(3)
3:55.711 standard_rotation s pyroblast Fluffy_Pillow 49502.0/50000: 99% mana fireball(3), heating_up
3:56.524 standard_rotation r fire_blast Fluffy_Pillow 49315.0/50000: 99% mana fireball(3), heating_up, firestorm
3:56.887 standard_rotation o pyroblast Fluffy_Pillow 49178.0/50000: 98% mana fireball(3), hot_streak, firestorm
3:58.049 standard_rotation o pyroblast Fluffy_Pillow 49340.0/50000: 99% mana fireball(3), heating_up, firestorm
3:59.211 standard_rotation o pyroblast Fluffy_Pillow 49502.0/50000: 99% mana fireball(3), hot_streak, firestorm
4:00.374 default M mirror_image Fluffy_Pillow 49665.0/50000: 99% mana fireball(3), heating_up
4:01.685 standard_rotation v scorch Fluffy_Pillow 49976.0/50000: 100% mana heating_up
4:02.848 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:04.022 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:04.181 standard_rotation r fire_blast Fluffy_Pillow 49779.0/50000: 100% mana
4:05.185 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:06.357 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:07.520 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:08.682 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:09.856 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:11.018 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:12.181 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:12.181 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
4:13.344 standard_rotation v scorch Fluffy_Pillow 49168.0/50000: 98% mana hot_streak
4:14.507 standard_rotation q pyroblast Fluffy_Pillow 49505.0/50000: 99% mana hot_streak
4:15.669 standard_rotation v scorch Fluffy_Pillow 49667.0/50000: 99% mana
4:16.831 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:17.995 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:19.167 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up
4:20.331 standard_rotation r fire_blast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:20.331 standard_rotation q pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak
4:21.493 standard_rotation v scorch Fluffy_Pillow 49168.0/50000: 98% mana hot_streak
4:22.656 standard_rotation q pyroblast Fluffy_Pillow 49505.0/50000: 99% mana hot_streak
4:23.818 standard_rotation v scorch Fluffy_Pillow 49667.0/50000: 99% mana hot_streak
4:24.979 standard_rotation q pyroblast Fluffy_Pillow 49503.0/50000: 99% mana hot_streak
4:26.142 standard_rotation v scorch Fluffy_Pillow 49666.0/50000: 99% mana
4:27.305 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:28.469 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:29.639 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana
4:30.801 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:31.963 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:33.137 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:34.298 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:35.461 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:36.634 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:37.796 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:38.959 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:40.133 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:40.133 standard_rotation r fire_blast Fluffy_Pillow 49679.0/50000: 99% mana
4:41.297 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:42.468 combustion_phase c fireball Fluffy_Pillow 49677.0/50000: 99% mana
4:43.768 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana
4:43.768 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, rune_of_power
4:44.210 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, heating_up, rune_of_power
4:44.210 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
4:45.374 combustion_phase Y pyroblast Fluffy_Pillow 45106.0/50000: 90% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:46.538 combustion_phase Y pyroblast Fluffy_Pillow 45270.0/50000: 91% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:47.700 combustion_phase Y pyroblast Fluffy_Pillow 45432.0/50000: 91% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:48.863 combustion_phase U fire_blast Fluffy_Pillow 45595.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
4:48.863 combustion_phase Z pyroblast Fluffy_Pillow 45095.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:50.026 combustion_phase b phoenix_flames Fluffy_Pillow 45258.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
4:51.189 combustion_phase Y pyroblast Fluffy_Pillow 46421.0/50000: 93% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:52.351 combustion_phase Y pyroblast Fluffy_Pillow 46583.0/50000: 93% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:53.514 combustion_phase Y pyroblast Fluffy_Pillow 46746.0/50000: 93% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:54.675 combustion_phase Y pyroblast Fluffy_Pillow 46907.0/50000: 94% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:55.838 default O rune_of_power Fluffy_Pillow 47070.0/50000: 94% mana hot_streak, firestorm, gladiators_badge
4:57.001 rop_phase f pyroblast Fluffy_Pillow 48233.0/50000: 96% mana hot_streak, rune_of_power, firestorm, gladiators_badge
4:57.001 rop_phase h fire_blast Fluffy_Pillow 47233.0/50000: 94% mana rune_of_power, firestorm, gladiators_badge
4:58.164 rop_phase g pyroblast Fluffy_Pillow 47896.0/50000: 96% mana hot_streak, rune_of_power, gladiators_badge
4:58.228 rop_phase h fire_blast Fluffy_Pillow 46896.0/50000: 94% mana rune_of_power, gladiators_badge
4:59.327 rop_phase m scorch Fluffy_Pillow 47559.0/50000: 95% mana hot_streak, rune_of_power
5:00.488 rop_phase g pyroblast Fluffy_Pillow 48220.0/50000: 96% mana hot_streak, rune_of_power
5:01.651 rop_phase m scorch Fluffy_Pillow 48383.0/50000: 97% mana rune_of_power
5:02.813 rop_phase m scorch Fluffy_Pillow 49045.0/50000: 98% mana rune_of_power
5:03.975 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:05.150 rop_phase m scorch Fluffy_Pillow 49679.0/50000: 99% mana rune_of_power
5:05.949 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
5:06.312 rop_phase k pyroblast Fluffy_Pillow 49363.0/50000: 99% mana heating_up, rune_of_power
5:07.487 rop_phase m scorch Fluffy_Pillow 49538.0/50000: 99% mana heating_up, rune_of_power
5:08.649 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:09.822 standard_rotation t phoenix_flames Fluffy_Pillow 49677.0/50000: 99% mana heating_up
5:10.986 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana
5:12.149 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
5:13.311 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
5:14.484 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
5:14.484 standard_rotation r fire_blast Fluffy_Pillow 49677.0/50000: 99% mana
5:15.646 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
5:16.819 default N use_item_dreadfire_vessel Fluffy_Pillow 49677.0/50000: 99% mana
5:16.819 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
5:17.982 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
5:19.145 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up

Stats

Level Bonus (60) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 198 -2 196 196 0
Agility 306 2 308 308 0
Stamina 414 0 2018 1922 1508
Intellect 450 0 1816 1635 1108 (132)
Spirit 0 0 0 0 0
Health 40360 38440 0
Mana 50000 50000 0
Spell Power 1816 1635 0
Melee Crit 10.46% 10.46% 156
Spell Crit 25.46% 25.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="night_elf"
source=default
spec=fire
level=60
race=night_elf
timeofday=day
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

no_race : 5050 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5049.7 5049.7 9.6 / 0.189% 787.9 / 15.6% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
798.4 793.7 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
no_race 5050
Conflagration Flare Up 23 0.5% 29.9 9.72sec 236 0 Direct 29.9 150 376 236 38.1%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.85 29.85 0.00 0.00 0.0000 0.0000 7045.17 7045.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.88% 18.47 5 35 149.98 130 255 150.03 131 179 2770 2770 0.00%
crit 38.12% 11.38 2 25 375.61 260 510 376.01 267 468 4275 4275 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 10 0.2% 0.8 94.69sec 3903 3359 Direct 0.8 0 3903 3903 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.80 0.80 0.00 0.00 1.1625 0.0000 3137.28 3137.28 0.00% 3358.98 3358.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.80 0 4 3903.38 3786 4398 2297.23 0 4398 3137 3137 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.81
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 160 3.2% 3.3 103.96sec 14524 0 Direct 3.3 11652 23268 14623 25.6%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.28 0.00 0.00 0.0000 0.0000 47945.89 47945.89 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.40% 2.44 0 4 11652.08 11342 12023 11487.07 0 12023 28419 28419 0.00%
crit 25.60% 0.84 0 4 23267.71 22685 24046 14210.08 0 24046 19527 19527 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 600 11.9% 42.3 7.16sec 4255 0 Direct 42.3 0 4255 4255 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.29 42.29 0.00 0.00 0.0000 0.0000 179942.81 179942.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.29 33 50 4254.99 3045 5979 4256.93 4031 4498 179943 179943 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.73
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:3.05
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.31
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.21
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 611 (639) 12.1% (12.7%) 77.4 3.43sec 2479 1491 Direct 77.4 (220.8) 1656 3444 2370 39.9% (39.9%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.38 77.38 0.00 0.00 1.6627 0.0000 183421.94 183421.94 0.00% 1491.11 1491.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.06% 46.47 27 65 1656.24 1437 2575 1656.61 1529 1800 76979 76979 0.00%
crit 39.94% 30.90 18 46 3444.26 2874 5643 3447.69 3156 3750 106442 106442 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.69
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.88
    standard_rotation
    [w]:51.87
    Conflagration 28 0.6% 77.4 3.43sec 109 0 Periodic 143.4 36 90 59 42.7% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.38 0.00 143.41 143.41 0.0000 1.4472 8434.42 8434.42 0.00% 40.64 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.25% 82.10 55 111 35.51 0 57 35.50 34 38 2916 2916 0.00%
crit 42.75% 61.30 41 87 90.02 0 125 90.12 83 98 5519 5519 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 955 18.9% 264.7 1.13sec 1083 0 Periodic 299.2 958 0 958 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.67 0.00 299.20 299.20 0.0000 1.0000 286641.04 286641.04 0.00% 958.02 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 957.97 152 2922 959.17 819 1118 286641 286641 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.42sec 3649 4718

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7739 0.0000 0.00 0.00 0.00% 4717.52 4717.52

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 97  / 37 0.7% 236.0 3.45sec 46 33 Direct 235.3 37 75 46 24.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.03 235.29 0.00 0.00 1.3988 0.0000 10916.34 10916.34 0.00% 33.06 33.06
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.57% 177.81 114 211 37.29 29 53 37.37 35 41 6631 6631 0.00%
crit 24.43% 57.48 29 85 74.54 57 106 74.71 65 86 4285 4285 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.71
Phoenix Flames 0 (243) 0.0% (4.8%) 14.1 21.70sec 5149 4677

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.12 0.00 0.00 0.00 1.1010 0.0000 0.00 0.00 0.00% 4677.16 4677.16

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.14
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.31
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.67
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 243 4.8% 14.1 21.69sec 5159 0 Direct 14.1 2097 5983 5160 78.8%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 0.00 0.00 0.0000 0.0000 72734.46 72734.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.20% 2.99 0 8 2096.97 1730 3397 2047.43 0 3397 6267 6267 0.00%
crit 78.80% 11.11 6 16 5983.24 3460 6795 5990.14 5253 6375 66468 66468 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2042 (2172) 40.4% (43.0%) 96.6 3.08sec 6744 6035 Direct 97.3 (275.0) 3084 7742 6297 68.9% (68.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.64 97.32 0.00 0.00 1.1175 0.0000 612670.83 612670.83 0.00% 6034.90 6034.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.05% 30.22 17 45 3083.72 2620 5145 3082.72 2787 3366 93194 93194 0.00%
crit 68.95% 67.10 33 104 7742.48 5240 10290 7768.65 7059 8810 519477 519477 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.13
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.40
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.22
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.78
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.42
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.43
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.85
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.34
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.24
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.85
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 130 2.6% 97.3 3.07sec 402 0 Periodic 177.7 136 348 220 39.6% 86.5%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.32 0.00 177.70 177.70 0.0000 1.4625 39104.26 39104.26 0.00% 150.47 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.44% 107.40 71 149 136.12 5 234 136.13 128 145 14620 14620 0.00%
crit 39.56% 70.29 44 97 348.27 10 468 348.80 326 382 24484 24484 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 210 4.2% 33.6 7.41sec 1886 1636 Direct 33.6 0 1887 1887 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.62 33.61 0.00 0.00 1.1533 0.0000 63417.46 63417.46 0.00% 1635.61 1635.61
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.61 18 51 1886.69 953 3341 1886.95 1692 2164 63417 63417 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.64
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:8.01
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.31
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
no_race
Combustion 4.7 70.68sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.67
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_race
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_race
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.18
Rune of Power 5.3 59.59sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 0.00 0.00 1.1120 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.33
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.7sec 70.7sec 11.8sec 18.40% 0.00% 105.7 (105.7) 4.5

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:49.1s / 89.3s
  • trigger_min/max:49.1s / 89.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.40%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.5 24.9 9.1sec 4.2sec 5.1sec 36.85% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 47.1s
  • trigger_min/max:1.3s / 47.1s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 31.9s

Stack Uptimes

  • fireball_1:20.46%
  • fireball_2:9.12%
  • fireball_3:4.50%
  • fireball_4:1.94%
  • fireball_5:0.64%
  • fireball_6:0.17%
  • fireball_7:0.03%
  • fireball_8:0.03%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.8 36.5sec 32.5sec 4.2sec 10.96% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 173.8s
  • trigger_min/max:0.8s / 173.8s
  • trigger_pct:10.14%
  • duration_min/max:0.0s / 16.4s

Stack Uptimes

  • firestorm_1:10.96%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.2sec 72.8sec 14.7sec 22.90% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 89.3s
  • trigger_min/max:60.0s / 89.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.90%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.1 0.0 3.1sec 3.1sec 1.1sec 35.17% 46.73% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 18.5s
  • trigger_min/max:0.2s / 18.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • heating_up_1:35.17%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.3 0.0 3.6sec 3.6sec 0.6sec 13.02% 86.43% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 29.5s
  • trigger_min/max:0.5s / 29.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.2s

Stack Uptimes

  • hot_streak_1:13.02%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 308.2sec 0.0sec 23.7sec 9.34% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.34%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.2sec 11.9sec 38.92% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 72.6s
  • trigger_min/max:4.9s / 72.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.9s

Stack Uptimes

  • rune_of_power_1:38.92%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.1 71.0 124.0 3.1s 0.2s 18.5s
Heating Up removed 11.4 2.0 21.0 23.7s 0.9s 206.2s
Heating Up converted with Fire Blast 23.2 13.0 34.0 12.1s 0.5s 87.1s
Hot Streak procs 84.3 60.0 110.0 3.6s 0.5s 29.5s
Hot Streak spells used 264.7 211.0 319.0 1.1s 0.0s 5.4s
Hot Streak spell crits 185.0 135.0 237.0 1.6s 0.0s 17.3s
Hot Streak spell crits wasted 4.6 0.0 12.0 65.5s 0.1s 319.0s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.08% 9.81% 17.95% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3160.00012.1830.9470.00012.183
Rune of Power13.9190.00039.64276.23717.595129.328
Fire Blast0.0950.00023.4684.0511.30026.863
Dragon's Breath137.59845.326350.378286.373193.158359.850
Combustion2.2081.30010.82110.3755.59521.695
Phoenix Flames0.2000.00025.4342.8231.73825.434

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
no_race
mana_regen Mana 2176.10 238483.56 100.00% 109.59 61679.41 20.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.65 798.38 61690.3 48580.3 42431.0 50000.0
Usage Type Count Total Avg RPE APR
no_race
combustion Mana 4.7 23326.6 5000.0 5003.3 0.0
dragons_breath Mana 0.8 1611.1 2000.0 2004.5 1.9
fire_blast Mana 42.3 21145.1 500.0 500.0 8.5
fireball Mana 77.4 77410.3 1000.0 1000.3 2.5
mirror_image Mana 3.0 1991.3 665.7 665.7 5.5
pyroblast Mana 97.6 97648.0 1000.0 1010.4 6.7
scorch Mana 33.6 16789.7 500.0 499.4 3.8

Statistics & Data Analysis

Fight Length
no_race Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
no_race Damage Per Second
Count 1717
Mean 5049.71
Minimum 4464.20
Maximum 5963.82
Spread ( max - min ) 1499.63
Range [ ( max - min ) / 2 * 100% ] 14.85%
Standard Deviation 201.9846
5th Percentile 4744.92
95th Percentile 5397.44
( 95th Percentile - 5th Percentile ) 652.53
Mean Distribution
Standard Deviation 4.8745
95.00% Confidence Interval ( 5040.16 - 5059.27 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6147
0.1 Scale Factor Error with Delta=300 349
0.05 Scale Factor Error with Delta=300 1394
0.01 Scale Factor Error with Delta=300 34828
Priority Target DPS
no_race Priority Target Damage Per Second
Count 1717
Mean 5049.71
Minimum 4464.20
Maximum 5963.82
Spread ( max - min ) 1499.63
Range [ ( max - min ) / 2 * 100% ] 14.85%
Standard Deviation 201.9846
5th Percentile 4744.92
95th Percentile 5397.44
( 95th Percentile - 5th Percentile ) 652.53
Mean Distribution
Standard Deviation 4.8745
95.00% Confidence Interval ( 5040.16 - 5059.27 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6147
0.1 Scale Factor Error with Delta=300 349
0.05 Scale Factor Error with Delta=300 1394
0.01 Scale Factor Error with Delta=300 34828
DPS(e)
no_race Damage Per Second (Effective)
Count 1717
Mean 5049.71
Minimum 4464.20
Maximum 5963.82
Spread ( max - min ) 1499.63
Range [ ( max - min ) / 2 * 100% ] 14.85%
Damage
no_race Damage
Count 1717
Mean 1504495.56
Minimum 1146469.83
Maximum 1921540.34
Spread ( max - min ) 775070.51
Range [ ( max - min ) / 2 * 100% ] 25.76%
DTPS
no_race Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
no_race Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
no_race Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
no_race Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
no_race Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
no_race Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
no_raceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
no_race Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.33 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.18 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.66 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.73 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.67 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.13 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.40 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.22 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.14 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.69 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.64 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.81 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.78 pyroblast,if=buff.firestorm.react
g 9.42 pyroblast,if=buff.hot_streak.react
h 3.05 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.31 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.43 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.31 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 8.01 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.88 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.85 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.34 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.24 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.21 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.85 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.67 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.31 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.87 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUYYYYZUZUZbZbZUOgnnnnNnnigngwrpwwwwwwwwwrpooowpwwrpwwwrpooYcWTZZUZUZUZbZbZUZOlnnnfffnigwwwwwwwrpwwrpoooNwoowpwMwwrpwwwwcWUTbZUZUZbZdUZZeOnnnnignnntwpwrpwwwwwrpwwwwwrpwwrpwOnhignnnnnnwwcWUTbZUZbZUZdadavstvrsoooNorovsvMOghmmkmkmhkmmkvvrqvqvvsvrqvqvvsoooqvvsvacWUTbZUZUZbZdadaOfifmkmhgmkmmktrqvvsvvs

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask no_race 50000.0/50000: 100% mana
Pre precombat 1 food no_race 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.744 combustion_phase b phoenix_flames Fluffy_Pillow 43944.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.639 combustion_phase Z pyroblast Fluffy_Pillow 44839.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:02.639 combustion_phase U fire_blast Fluffy_Pillow 43839.0/50000: 88% mana bloodlust, combustion, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:03.532 combustion_phase Y pyroblast Fluffy_Pillow 44232.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:04.425 combustion_phase Y pyroblast Fluffy_Pillow 44125.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:05.320 combustion_phase Y pyroblast Fluffy_Pillow 44020.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:06.214 combustion_phase Y pyroblast Fluffy_Pillow 43914.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
0:07.110 combustion_phase Z pyroblast Fluffy_Pillow 43810.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.110 combustion_phase U fire_blast Fluffy_Pillow 42810.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.005 combustion_phase Z pyroblast Fluffy_Pillow 43205.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.005 combustion_phase U fire_blast Fluffy_Pillow 42205.0/50000: 84% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.898 combustion_phase Z pyroblast Fluffy_Pillow 42598.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.792 combustion_phase b phoenix_flames Fluffy_Pillow 42492.0/50000: 85% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.687 combustion_phase Z pyroblast Fluffy_Pillow 43387.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.580 combustion_phase b phoenix_flames Fluffy_Pillow 43280.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.475 combustion_phase Z pyroblast Fluffy_Pillow 44175.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.275 combustion_phase U fire_blast Fluffy_Pillow 43975.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.370 default O rune_of_power Fluffy_Pillow 43570.0/50000: 87% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:14.265 rop_phase g pyroblast Fluffy_Pillow 44465.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.159 rop_phase n fireball Fluffy_Pillow 44359.0/50000: 89% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:16.499 rop_phase n fireball Fluffy_Pillow 44699.0/50000: 89% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.839 rop_phase n fireball Fluffy_Pillow 45039.0/50000: 90% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:19.178 rop_phase n fireball Fluffy_Pillow 45378.0/50000: 91% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:20.518 default N use_item_dreadfire_vessel Fluffy_Pillow 45718.0/50000: 91% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:20.518 rop_phase n fireball Fluffy_Pillow 45718.0/50000: 91% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:21.857 rop_phase n fireball Fluffy_Pillow 46057.0/50000: 92% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:23.157 rop_phase i fire_blast Fluffy_Pillow 47357.0/50000: 95% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:23.199 rop_phase g pyroblast Fluffy_Pillow 45899.0/50000: 92% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:24.097 rop_phase n fireball Fluffy_Pillow 45797.0/50000: 92% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:25.438 rop_phase g pyroblast Fluffy_Pillow 46138.0/50000: 92% mana bloodlust, hot_streak, rune_of_power
0:26.332 standard_rotation w fireball Fluffy_Pillow 46032.0/50000: 92% mana bloodlust, fireball, heating_up
0:27.232 standard_rotation r fire_blast Fluffy_Pillow 46932.0/50000: 94% mana bloodlust, fireball, heating_up
0:27.673 standard_rotation p pyroblast Fluffy_Pillow 45873.0/50000: 92% mana bloodlust, fireball, hot_streak
0:28.569 standard_rotation w fireball Fluffy_Pillow 45769.0/50000: 92% mana bloodlust, heating_up
0:29.907 standard_rotation w fireball Fluffy_Pillow 46107.0/50000: 92% mana bloodlust, heating_up
0:31.247 standard_rotation w fireball Fluffy_Pillow 46447.0/50000: 93% mana bloodlust, fireball
0:32.588 standard_rotation w fireball Fluffy_Pillow 46788.0/50000: 94% mana bloodlust, fireball(2)
0:33.929 standard_rotation w fireball Fluffy_Pillow 47129.0/50000: 94% mana bloodlust, heating_up
0:35.269 standard_rotation w fireball Fluffy_Pillow 47469.0/50000: 95% mana bloodlust, fireball
0:36.610 standard_rotation w fireball Fluffy_Pillow 47810.0/50000: 96% mana bloodlust, fireball(2)
0:37.949 standard_rotation w fireball Fluffy_Pillow 48149.0/50000: 96% mana bloodlust, fireball(3)
0:39.290 standard_rotation w fireball Fluffy_Pillow 48490.0/50000: 97% mana bloodlust, fireball(4)
0:40.390 standard_rotation r fire_blast Fluffy_Pillow 49590.0/50000: 99% mana bloodlust, heating_up
0:40.630 standard_rotation p pyroblast Fluffy_Pillow 48330.0/50000: 97% mana bloodlust, hot_streak, firestorm
0:41.524 standard_rotation o pyroblast Fluffy_Pillow 48224.0/50000: 96% mana fireball, heating_up, firestorm
0:42.685 standard_rotation o pyroblast Fluffy_Pillow 48385.0/50000: 97% mana fireball, hot_streak, firestorm
0:43.847 standard_rotation o pyroblast Fluffy_Pillow 48547.0/50000: 97% mana fireball, heating_up, firestorm
0:45.010 standard_rotation w fireball Fluffy_Pillow 48710.0/50000: 97% mana fireball, hot_streak
0:46.751 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
0:47.913 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball(2)
0:49.655 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
0:51.055 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:51.397 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak
0:52.560 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
0:54.301 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
0:56.041 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
0:57.341 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:57.781 standard_rotation p pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak, firestorm
0:58.943 standard_rotation o pyroblast Fluffy_Pillow 49102.0/50000: 98% mana fireball, heating_up, firestorm
1:00.104 standard_rotation o pyroblast Fluffy_Pillow 49263.0/50000: 99% mana fireball, hot_streak, firestorm
1:01.267 combustion_phase Y pyroblast Fluffy_Pillow 49426.0/50000: 99% mana fireball, heating_up, firestorm
1:02.429 combustion_phase c fireball Fluffy_Pillow 49588.0/50000: 99% mana fireball, hot_streak
1:03.729 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
1:04.170 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44441.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power
1:04.170 combustion_phase Z pyroblast Fluffy_Pillow 44441.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, gladiators_badge
1:05.333 combustion_phase Z pyroblast Fluffy_Pillow 44604.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:05.333 combustion_phase U fire_blast Fluffy_Pillow 43604.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:06.494 combustion_phase Z pyroblast Fluffy_Pillow 44265.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:06.494 combustion_phase U fire_blast Fluffy_Pillow 43265.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:07.657 combustion_phase Z pyroblast Fluffy_Pillow 43928.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:07.657 combustion_phase U fire_blast Fluffy_Pillow 42928.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
1:08.820 combustion_phase Z pyroblast Fluffy_Pillow 43591.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:09.984 combustion_phase b phoenix_flames Fluffy_Pillow 43755.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
1:11.148 combustion_phase Z pyroblast Fluffy_Pillow 44919.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:12.312 combustion_phase b phoenix_flames Fluffy_Pillow 45083.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
1:13.475 combustion_phase Z pyroblast Fluffy_Pillow 46246.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:14.375 combustion_phase U fire_blast Fluffy_Pillow 46146.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.636 combustion_phase Z pyroblast Fluffy_Pillow 45907.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:15.798 default O rune_of_power Fluffy_Pillow 46069.0/50000: 92% mana heating_up, gladiators_badge
1:16.961 rop_phase l phoenix_flames Fluffy_Pillow 47232.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
1:18.123 rop_phase n fireball Fluffy_Pillow 48394.0/50000: 97% mana rune_of_power, gladiators_badge
1:19.863 rop_phase n fireball Fluffy_Pillow 49003.0/50000: 98% mana rune_of_power
1:21.605 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up, rune_of_power
1:23.348 rop_phase f pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak, rune_of_power, firestorm
1:24.511 rop_phase f pyroblast Fluffy_Pillow 49169.0/50000: 98% mana fireball, heating_up, rune_of_power, firestorm
1:25.672 rop_phase f pyroblast Fluffy_Pillow 49330.0/50000: 99% mana fireball, hot_streak, rune_of_power, firestorm
1:26.834 rop_phase n fireball Fluffy_Pillow 49492.0/50000: 99% mana fireball, heating_up, rune_of_power
1:28.134 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up, rune_of_power
1:28.576 rop_phase g pyroblast Fluffy_Pillow 48942.0/50000: 98% mana fireball, hot_streak, rune_of_power
1:29.738 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball(2)
1:31.480 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:33.222 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
1:34.964 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:36.705 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:38.446 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
1:40.186 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(4)
1:41.486 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:41.928 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
1:43.091 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
1:44.833 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:46.233 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:46.576 standard_rotation p pyroblast Fluffy_Pillow 48843.0/50000: 98% mana hot_streak, firestorm
1:47.738 standard_rotation o pyroblast Fluffy_Pillow 49005.0/50000: 98% mana fireball, heating_up, firestorm
1:48.901 standard_rotation o pyroblast Fluffy_Pillow 49168.0/50000: 98% mana fireball, hot_streak, firestorm
1:50.064 standard_rotation o pyroblast Fluffy_Pillow 49331.0/50000: 99% mana fireball, heating_up, firestorm
1:51.227 default N use_item_dreadfire_vessel Fluffy_Pillow 49494.0/50000: 99% mana fireball, hot_streak, firestorm
1:51.227 standard_rotation w fireball Fluffy_Pillow 49494.0/50000: 99% mana fireball, hot_streak, firestorm
1:52.969 standard_rotation o pyroblast Fluffy_Pillow 49005.0/50000: 98% mana fireball, hot_streak, firestorm
1:54.132 standard_rotation o pyroblast Fluffy_Pillow 49168.0/50000: 98% mana fireball(2), heating_up, firestorm
1:55.294 standard_rotation w fireball Fluffy_Pillow 49330.0/50000: 99% mana fireball(2), hot_streak
1:57.034 standard_rotation p pyroblast Fluffy_Pillow 49003.0/50000: 98% mana fireball(2), hot_streak
1:58.196 standard_rotation w fireball Fluffy_Pillow 49165.0/50000: 98% mana fireball(3)
1:59.937 default M mirror_image Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
2:01.164 standard_rotation w fireball Fluffy_Pillow 49231.0/50000: 98% mana fireball(4)
2:02.906 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4)
2:04.306 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:04.646 standard_rotation p pyroblast Fluffy_Pillow 48840.0/50000: 98% mana hot_streak
2:05.809 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
2:07.551 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:09.292 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:11.032 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
2:12.772 combustion_phase c fireball Fluffy_Pillow 49003.0/50000: 98% mana heating_up
2:14.072 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball
2:14.072 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power
2:14.514 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power
2:14.514 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, gladiators_badge
2:15.676 combustion_phase Z pyroblast Fluffy_Pillow 45104.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:15.676 combustion_phase U fire_blast Fluffy_Pillow 44104.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:16.838 combustion_phase Z pyroblast Fluffy_Pillow 44766.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:16.838 combustion_phase U fire_blast Fluffy_Pillow 43766.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:18.000 combustion_phase Z pyroblast Fluffy_Pillow 44428.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:19.162 combustion_phase b phoenix_flames Fluffy_Pillow 44590.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
2:20.325 combustion_phase Z pyroblast Fluffy_Pillow 45753.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:21.487 combustion_phase d scorch Fluffy_Pillow 45915.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:21.887 combustion_phase U fire_blast Fluffy_Pillow 46315.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:22.651 combustion_phase Z pyroblast Fluffy_Pillow 46079.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.814 combustion_phase Z pyroblast Fluffy_Pillow 46242.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:24.976 combustion_phase e dragons_breath Fluffy_Pillow 46404.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:26.138 default O rune_of_power Fluffy_Pillow 45566.0/50000: 91% mana heating_up, gladiators_badge
2:27.302 rop_phase n fireball Fluffy_Pillow 46730.0/50000: 93% mana heating_up, rune_of_power, gladiators_badge
2:29.043 rop_phase n fireball Fluffy_Pillow 47471.0/50000: 95% mana heating_up, rune_of_power, gladiators_badge
2:30.782 rop_phase n fireball Fluffy_Pillow 48210.0/50000: 96% mana fireball, rune_of_power
2:32.525 rop_phase n fireball Fluffy_Pillow 48953.0/50000: 98% mana fireball(2), rune_of_power
2:34.125 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
2:34.265 rop_phase g pyroblast Fluffy_Pillow 48640.0/50000: 97% mana hot_streak, rune_of_power
2:35.428 rop_phase n fireball Fluffy_Pillow 48803.0/50000: 98% mana fireball, rune_of_power
2:37.169 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
2:38.911 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), rune_of_power
2:40.651 standard_rotation t phoenix_flames Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
2:41.814 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
2:43.554 standard_rotation p pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak
2:44.715 standard_rotation w fireball Fluffy_Pillow 49164.0/50000: 98% mana fireball, heating_up
2:46.015 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
2:46.456 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana fireball, hot_streak
2:47.619 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball(2)
2:49.360 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
2:51.103 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(3)
2:52.844 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4)
2:54.586 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(5)
2:55.886 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:56.328 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:57.491 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
2:59.234 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
3:00.976 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
3:02.717 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
3:04.459 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4)
3:05.759 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:06.201 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
3:07.363 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
3:09.102 standard_rotation w fireball Fluffy_Pillow 49002.0/50000: 98% mana fireball
3:10.402 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:10.843 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
3:12.005 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
3:13.746 default O rune_of_power Fluffy_Pillow 49004.0/50000: 98% mana fireball
3:14.911 rop_phase n fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), rune_of_power
3:15.911 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), rune_of_power
3:16.411 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), heating_up, rune_of_power
3:16.653 rop_phase g pyroblast Fluffy_Pillow 48742.0/50000: 97% mana fireball(2), hot_streak, rune_of_power
3:17.815 rop_phase n fireball Fluffy_Pillow 48904.0/50000: 98% mana fireball(3), rune_of_power
3:19.556 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3), rune_of_power
3:21.297 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(4), rune_of_power
3:23.040 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up, rune_of_power
3:24.782 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
3:26.523 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), rune_of_power
3:28.265 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
3:30.007 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:31.748 combustion_phase c fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:33.048 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(3)
3:33.048 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(3), rune_of_power
3:33.488 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(3), heating_up, rune_of_power
3:33.488 combustion_phase b phoenix_flames Fluffy_Pillow 43940.0/50000: 88% mana combustion, fireball(3), heating_up, rune_of_power, gladiators_badge
3:34.650 combustion_phase Z pyroblast Fluffy_Pillow 45102.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:34.650 combustion_phase U fire_blast Fluffy_Pillow 44102.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
3:35.813 combustion_phase Z pyroblast Fluffy_Pillow 44765.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:36.975 combustion_phase b phoenix_flames Fluffy_Pillow 44927.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:38.138 combustion_phase Z pyroblast Fluffy_Pillow 46090.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:39.038 combustion_phase U fire_blast Fluffy_Pillow 45990.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:39.300 combustion_phase Z pyroblast Fluffy_Pillow 45752.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:40.461 combustion_phase d scorch Fluffy_Pillow 45913.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
3:41.624 combustion_phase a pyroblast Fluffy_Pillow 46576.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
3:42.796 combustion_phase d scorch Fluffy_Pillow 46748.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
3:43.958 combustion_phase a pyroblast Fluffy_Pillow 47410.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
3:45.132 standard_rotation v scorch Fluffy_Pillow 47584.0/50000: 95% mana heating_up, gladiators_badge
3:46.293 standard_rotation s pyroblast Fluffy_Pillow 48245.0/50000: 96% mana heating_up, gladiators_badge
3:47.468 standard_rotation t phoenix_flames Fluffy_Pillow 48420.0/50000: 97% mana gladiators_badge
3:48.630 standard_rotation v scorch Fluffy_Pillow 49582.0/50000: 99% mana
3:48.630 standard_rotation r fire_blast Fluffy_Pillow 49582.0/50000: 99% mana
3:49.793 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
3:50.964 standard_rotation o pyroblast Fluffy_Pillow 49676.0/50000: 99% mana heating_up, firestorm
3:52.127 standard_rotation o pyroblast Fluffy_Pillow 49839.0/50000: 100% mana hot_streak, firestorm
3:53.289 standard_rotation o pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
3:54.452 default N use_item_dreadfire_vessel Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, firestorm
3:54.452 standard_rotation o pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, firestorm
3:55.252 standard_rotation r fire_blast Fluffy_Pillow 49800.0/50000: 100% mana heating_up, firestorm
3:55.614 standard_rotation o pyroblast Fluffy_Pillow 49662.0/50000: 99% mana hot_streak, firestorm
3:56.777 standard_rotation v scorch Fluffy_Pillow 49825.0/50000: 100% mana heating_up
3:57.941 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
3:59.111 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana heating_up
4:00.274 default M mirror_image Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:01.438 default O rune_of_power Fluffy_Pillow 49669.0/50000: 99% mana hot_streak
4:02.600 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power
4:02.600 rop_phase h fire_blast Fluffy_Pillow 49000.0/50000: 98% mana rune_of_power
4:03.763 rop_phase m scorch Fluffy_Pillow 49663.0/50000: 99% mana rune_of_power
4:04.927 rop_phase m scorch Fluffy_Pillow 49506.0/50000: 99% mana rune_of_power
4:06.089 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:07.262 rop_phase m scorch Fluffy_Pillow 49677.0/50000: 99% mana heating_up, rune_of_power
4:08.426 rop_phase k pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
4:09.599 rop_phase m scorch Fluffy_Pillow 49679.0/50000: 99% mana rune_of_power
4:09.888 rop_phase h fire_blast Fluffy_Pillow 49879.0/50000: 100% mana rune_of_power
4:10.762 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
4:11.934 rop_phase m scorch Fluffy_Pillow 49677.0/50000: 99% mana rune_of_power
4:13.096 rop_phase m scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
4:14.257 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
4:15.432 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:16.594 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:17.757 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:17.757 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
4:18.918 standard_rotation v scorch Fluffy_Pillow 49166.0/50000: 98% mana hot_streak
4:20.080 standard_rotation q pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak
4:21.242 standard_rotation v scorch Fluffy_Pillow 49666.0/50000: 99% mana
4:22.406 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
4:23.568 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:24.742 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up
4:25.905 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:25.905 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
4:27.068 standard_rotation v scorch Fluffy_Pillow 49168.0/50000: 98% mana hot_streak
4:28.232 standard_rotation q pyroblast Fluffy_Pillow 49506.0/50000: 99% mana hot_streak
4:29.395 standard_rotation v scorch Fluffy_Pillow 49669.0/50000: 99% mana
4:30.558 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:31.719 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:32.894 standard_rotation o pyroblast Fluffy_Pillow 49678.0/50000: 99% mana heating_up, firestorm
4:34.058 standard_rotation o pyroblast Fluffy_Pillow 49842.0/50000: 100% mana hot_streak, firestorm
4:35.221 standard_rotation o pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
4:36.384 standard_rotation q pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:37.547 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana
4:38.709 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:39.871 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:41.045 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up
4:42.208 combustion_phase a pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:43.381 combustion_phase c fireball Fluffy_Pillow 49678.0/50000: 99% mana
4:44.681 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana
4:44.681 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, rune_of_power
4:45.122 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43941.0/50000: 88% mana combustion, heating_up, rune_of_power
4:45.122 combustion_phase b phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
4:46.285 combustion_phase Z pyroblast Fluffy_Pillow 45104.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:46.285 combustion_phase U fire_blast Fluffy_Pillow 44104.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
4:47.448 combustion_phase Z pyroblast Fluffy_Pillow 44767.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:48.548 combustion_phase U fire_blast Fluffy_Pillow 44867.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
4:48.612 combustion_phase Z pyroblast Fluffy_Pillow 44431.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:49.776 combustion_phase b phoenix_flames Fluffy_Pillow 44595.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
4:50.939 combustion_phase Z pyroblast Fluffy_Pillow 45758.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:52.102 combustion_phase d scorch Fluffy_Pillow 45921.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
4:53.266 combustion_phase a pyroblast Fluffy_Pillow 46585.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
4:54.437 combustion_phase d scorch Fluffy_Pillow 46756.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.600 combustion_phase a pyroblast Fluffy_Pillow 47419.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
4:56.771 default O rune_of_power Fluffy_Pillow 47590.0/50000: 95% mana heating_up, firestorm, gladiators_badge
4:57.936 rop_phase f pyroblast Fluffy_Pillow 48755.0/50000: 98% mana heating_up, rune_of_power, firestorm, gladiators_badge
4:57.936 rop_phase i fire_blast Fluffy_Pillow 47755.0/50000: 96% mana heating_up, rune_of_power, firestorm, gladiators_badge
4:59.097 rop_phase f pyroblast Fluffy_Pillow 48416.0/50000: 97% mana hot_streak, rune_of_power, firestorm, gladiators_badge
5:00.260 rop_phase m scorch Fluffy_Pillow 48579.0/50000: 97% mana heating_up, rune_of_power
5:01.422 rop_phase k pyroblast Fluffy_Pillow 49241.0/50000: 98% mana heating_up, rune_of_power
5:02.599 rop_phase m scorch Fluffy_Pillow 49418.0/50000: 99% mana rune_of_power
5:03.762 rop_phase h fire_blast Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power
5:03.935 rop_phase g pyroblast Fluffy_Pillow 49178.0/50000: 98% mana hot_streak, rune_of_power
5:05.098 rop_phase m scorch Fluffy_Pillow 49341.0/50000: 99% mana heating_up, rune_of_power
5:06.261 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
5:07.434 rop_phase m scorch Fluffy_Pillow 49678.0/50000: 99% mana rune_of_power
5:08.596 rop_phase m scorch Fluffy_Pillow 49504.0/50000: 99% mana rune_of_power
5:09.759 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
5:10.933 standard_rotation t phoenix_flames Fluffy_Pillow 49679.0/50000: 99% mana
5:12.033 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
5:12.095 standard_rotation q pyroblast Fluffy_Pillow 49562.0/50000: 99% mana hot_streak
5:13.259 standard_rotation v scorch Fluffy_Pillow 49726.0/50000: 99% mana
5:14.420 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
5:15.583 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
5:16.756 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
5:17.919 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
5:19.083 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 0 306 306 0
Stamina 414 0 2018 1922 1508
Intellect 450 0 1816 1635 1108 (132)
Spirit 0 0 0 0 0
Health 40360 38440 0
Mana 50000 50000 0
Spell Power 1816 1635 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="no_race"
source=default
spec=fire
level=60
race=none
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

pandaren : 5102 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5101.7 5101.7 9.5 / 0.187% 787.1 / 15.4% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
797.8 793.3 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
pandaren 5102
Conflagration Flare Up 24 0.5% 29.9 9.77sec 240 0 Direct 29.9 152 380 240 38.8%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.88 29.88 0.00 0.00 0.0000 0.0000 7181.75 7181.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.19% 18.28 2 39 151.86 131 257 151.94 132 178 2777 2777 0.00%
crit 38.81% 11.60 2 28 379.84 263 514 380.20 265 485 4405 4405 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 10 0.2% 0.8 93.29sec 3944 3393 Direct 0.8 0 3943 3943 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.79 0.79 0.00 0.00 1.1625 0.0000 3121.43 3121.43 0.00% 3392.85 3392.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.79 0 4 3943.42 3826 4438 2300.96 0 4438 3121 3121 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.79
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 158 3.1% 3.3 104.06sec 14405 0 Direct 3.3 11660 23335 14464 24.0%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.28 0.00 0.00 0.0000 0.0000 47501.05 47501.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.99% 2.50 0 4 11659.69 11342 12023 11526.40 0 12023 29100 29100 0.00%
crit 24.01% 0.79 0 4 23335.31 22685 24046 13685.91 0 24046 18401 18401 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 606 11.9% 42.3 7.15sec 4300 0 Direct 42.3 0 4300 4300 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.30 42.30 0.00 0.00 0.0000 0.0000 181897.57 181897.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.30 32 50 4300.16 3082 6034 4301.89 4096 4560 181898 181898 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.70
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:3.03
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.24
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.33
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 619 (648) 12.1% (12.7%) 77.5 3.42sec 2509 1509 Direct 77.4 (220.9) 1676 3486 2399 39.9% (39.9%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.46 77.45 0.00 0.00 1.6623 0.0000 185803.09 185803.09 0.00% 1509.38 1509.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.07% 46.52 27 66 1676.07 1454 2602 1676.84 1567 1828 77981 77981 0.00%
crit 39.93% 30.93 18 43 3486.39 2909 5695 3489.25 3253 3868 107822 107822 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.68
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.83
    standard_rotation
    [w]:51.99
    Conflagration 28 0.6% 77.4 3.40sec 110 0 Periodic 143.5 36 91 59 42.8% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.45 0.00 143.47 143.47 0.0000 1.4473 8535.07 8535.07 0.00% 41.11 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.24% 82.13 54 111 35.98 0 57 35.97 34 38 2955 2955 0.00%
crit 42.76% 61.34 39 84 90.98 0 126 91.06 85 99 5580 5580 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 966 18.9% 264.7 1.13sec 1095 0 Periodic 299.2 968 0 968 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.65 0.00 299.20 299.20 0.0000 1.0000 289784.02 289784.02 0.00% 968.52 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 968.44 153 2948 969.78 840 1138 289784 289784 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.46sec 3694 4775

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7738 0.0000 0.00 0.00 0.00% 4775.33 4775.33

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 33 Direct 235.3 38 75 47 24.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 236.03 235.28 0.00 0.00 1.3988 0.0000 11045.34 11045.34 0.00% 33.45 33.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.58% 177.83 115 208 37.73 29 53 37.81 35 41 6710 6710 0.00%
crit 24.42% 57.45 33 85 75.46 58 107 75.62 66 88 4335 4335 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.71
Phoenix Flames 0 (245) 0.0% (4.8%) 14.1 21.70sec 5199 4722

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.14 0.00 0.00 0.00 1.1009 0.0000 0.00 0.00 0.00% 4722.46 4722.46

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.13
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.32
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.68
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 245 4.8% 14.1 21.68sec 5212 0 Direct 14.1 2117 6044 5214 78.8%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.10 14.10 0.00 0.00 0.0000 0.0000 73495.67 73495.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.19% 2.99 0 7 2116.84 1751 3428 2075.76 0 3281 6323 6323 0.00%
crit 78.81% 11.11 6 17 6043.90 3502 6857 6049.75 5398 6488 67173 67173 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2062 (2194) 40.4% (43.0%) 96.4 3.11sec 6827 6107 Direct 97.1 (274.8) 3122 7836 6372 68.9% (68.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.41 97.10 0.00 0.00 1.1180 0.0000 618667.93 618667.93 0.00% 6106.67 6106.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.06% 30.16 17 47 3121.80 2652 5192 3121.67 2828 3446 94156 94156 0.00%
crit 68.94% 66.94 40 110 7835.59 5304 10385 7859.93 7031 8861 524512 524512 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:6.87
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.46
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.30
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.98
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.40
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.42
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.55
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.39
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.24
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.81
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 132 2.6% 97.1 3.11sec 407 0 Periodic 177.7 138 352 223 39.5% 86.5%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.10 0.00 177.67 177.67 0.0000 1.4623 39539.65 39539.65 0.00% 152.19 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.53% 107.55 71 142 137.91 5 236 137.93 130 146 14833 14833 0.00%
crit 39.47% 70.13 47 97 352.32 10 472 352.82 324 386 24707 24707 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 214 4.2% 33.7 7.77sec 1909 1656 Direct 33.7 0 1909 1909 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.72 33.72 0.00 0.00 1.1527 0.0000 64379.06 64379.06 0.00% 1656.10 1656.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.72 16 50 1909.31 1163 3371 1909.72 1698 2156 64379 64379 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.78
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:8.03
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.27
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
pandaren
Combustion 4.7 70.96sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.66
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pandaren
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pandaren
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.19
Rune of Power 5.3 59.24sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 0.00 0.00 0.00 1.1121 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.35
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.7sec 70.7sec 11.8sec 18.40% 0.00% 105.7 (105.7) 4.5

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:51.4s / 90.5s
  • trigger_min/max:51.4s / 90.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • combustion_1:18.40%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.6 24.9 9.1sec 4.2sec 5.1sec 36.79% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 47.6s
  • trigger_min/max:1.3s / 43.6s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 29.7s

Stack Uptimes

  • fireball_1:20.59%
  • fireball_2:8.94%
  • fireball_3:4.45%
  • fireball_4:1.94%
  • fireball_5:0.68%
  • fireball_6:0.17%
  • fireball_7:0.03%
  • fireball_8:0.06%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.7 0.8 36.6sec 32.6sec 4.2sec 10.85% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 181.4s
  • trigger_min/max:0.8s / 181.4s
  • trigger_pct:10.06%
  • duration_min/max:0.0s / 15.6s

Stack Uptimes

  • firestorm_1:10.85%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.2sec 72.8sec 14.8sec 22.91% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 90.5s
  • trigger_min/max:60.0s / 90.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.91%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.1 0.0 3.1sec 3.1sec 1.1sec 35.17% 46.72% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 18.5s
  • trigger_min/max:0.2s / 18.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • heating_up_1:35.17%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.3 0.0 3.6sec 3.6sec 0.6sec 13.04% 86.61% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 33.1s
  • trigger_min/max:0.5s / 33.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.3s

Stack Uptimes

  • hot_streak_1:13.04%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 306.0sec 0.0sec 23.8sec 9.47% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.47%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.1sec 12.0sec 38.98% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 70.8s
  • trigger_min/max:7.1s / 70.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.8s

Stack Uptimes

  • rune_of_power_1:38.98%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.1 74.0 122.0 3.1s 0.2s 18.5s
Heating Up removed 11.4 2.0 23.0 23.6s 0.7s 189.7s
Heating Up converted with Fire Blast 23.3 13.0 37.0 12.1s 0.5s 95.1s
Hot Streak procs 84.3 62.0 113.0 3.6s 0.5s 33.1s
Hot Streak spells used 264.7 211.0 319.0 1.1s 0.0s 5.2s
Hot Streak spell crits 185.0 141.0 238.0 1.6s 0.0s 16.3s
Hot Streak spell crits wasted 4.6 0.0 11.0 65.5s 0.0s 297.4s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.09% 9.35% 17.87% 0.5s 0.0s 4.2s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3230.00012.7420.9680.00013.588
Rune of Power13.8030.00037.89175.42516.445128.632
Fire Blast0.0960.00018.9854.0721.30032.609
Dragon's Breath139.27945.427305.983286.568196.768359.850
Combustion2.2091.30011.01310.3575.80224.551
Phoenix Flames0.2060.00026.7802.9271.73927.080

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
pandaren
mana_regen Mana 2173.56 238374.42 100.00% 109.67 61777.26 20.58%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.29 797.83 61789.8 48633.5 42267.0 50000.0
Usage Type Count Total Avg RPE APR
pandaren
combustion Mana 4.7 23297.7 5000.0 5003.4 0.0
dragons_breath Mana 0.8 1585.7 2000.0 2003.4 2.0
fire_blast Mana 42.3 21150.0 500.0 500.0 8.6
fireball Mana 77.5 77478.9 1000.0 1000.3 2.5
mirror_image Mana 3.0 1990.2 665.6 665.6 5.5
pyroblast Mana 97.4 97409.7 1000.0 1010.4 6.8
scorch Mana 33.7 16845.4 500.0 499.5 3.8

Statistics & Data Analysis

Fight Length
pandaren Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
pandaren Damage Per Second
Count 1717
Mean 5101.72
Minimum 4491.41
Maximum 5909.87
Spread ( max - min ) 1418.46
Range [ ( max - min ) / 2 * 100% ] 13.90%
Standard Deviation 201.3142
5th Percentile 4794.35
95th Percentile 5448.72
( 95th Percentile - 5th Percentile ) 654.37
Mean Distribution
Standard Deviation 4.8584
95.00% Confidence Interval ( 5092.20 - 5111.24 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5982
0.1 Scale Factor Error with Delta=300 346
0.05 Scale Factor Error with Delta=300 1384
0.01 Scale Factor Error with Delta=300 34597
Priority Target DPS
pandaren Priority Target Damage Per Second
Count 1717
Mean 5101.72
Minimum 4491.41
Maximum 5909.87
Spread ( max - min ) 1418.46
Range [ ( max - min ) / 2 * 100% ] 13.90%
Standard Deviation 201.3142
5th Percentile 4794.35
95th Percentile 5448.72
( 95th Percentile - 5th Percentile ) 654.37
Mean Distribution
Standard Deviation 4.8584
95.00% Confidence Interval ( 5092.20 - 5111.24 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5982
0.1 Scale Factor Error with Delta=300 346
0.05 Scale Factor Error with Delta=300 1384
0.01 Scale Factor Error with Delta=300 34597
DPS(e)
pandaren Damage Per Second (Effective)
Count 1717
Mean 5101.72
Minimum 4491.41
Maximum 5909.87
Spread ( max - min ) 1418.46
Range [ ( max - min ) / 2 * 100% ] 13.90%
Damage
pandaren Damage
Count 1717
Mean 1519906.28
Minimum 1162175.54
Maximum 1984163.77
Spread ( max - min ) 821988.23
Range [ ( max - min ) / 2 * 100% ] 27.04%
DTPS
pandaren Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
pandaren Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
pandaren Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
pandaren Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
pandaren Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
pandaren Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
pandarenTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
pandaren Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.29 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.35 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.19 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.66 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.70 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.66 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 6.87 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.46 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.30 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.13 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.68 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.78 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.79 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.98 pyroblast,if=buff.firestorm.react
g 9.40 pyroblast,if=buff.hot_streak.react
h 3.03 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.24 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.42 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.32 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 8.03 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.83 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.55 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.39 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.24 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.33 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.81 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.68 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.27 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.99 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUZZUZUZbZbZUZbZdaUOgnnnnNnignnnwwwrpwwwrpwwwwwwwwroooowrpwwwwwwrcWTYYUZUZbZUZbZeOlnnignnnnrpooowoowpwwwrNoooowpwrMwpwwrpwwrpoYYcWTZZUZUZbZUZbZeOnignnngnntwrpwwwwwwwrpooowoowoowpwrOghngnigncWUTbZYYUZYYYZYootqvrsoroNoqtvvrqvvsMvvOrgmkmffhgmmkmvrqvvsvvsvvsvvsvvsvoYcWUTZZUZUZbZbZUZeOmkhmkmmkmmigmqtqvrqvvsv

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask pandaren 50000.0/50000: 100% mana
Pre precombat 1 food pandaren 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, heating_up, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.742 combustion_phase Z pyroblast Fluffy_Pillow 43942.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.637 combustion_phase Z pyroblast Fluffy_Pillow 43837.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.637 combustion_phase U fire_blast Fluffy_Pillow 42837.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.530 combustion_phase Z pyroblast Fluffy_Pillow 43230.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.530 combustion_phase U fire_blast Fluffy_Pillow 42230.0/50000: 84% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.423 combustion_phase Z pyroblast Fluffy_Pillow 42623.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.318 combustion_phase b phoenix_flames Fluffy_Pillow 42518.0/50000: 85% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.212 combustion_phase Z pyroblast Fluffy_Pillow 43412.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.105 combustion_phase b phoenix_flames Fluffy_Pillow 43305.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.999 combustion_phase Z pyroblast Fluffy_Pillow 44199.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.999 combustion_phase U fire_blast Fluffy_Pillow 43199.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.894 combustion_phase Z pyroblast Fluffy_Pillow 43594.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.789 combustion_phase b phoenix_flames Fluffy_Pillow 43489.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.684 combustion_phase Z pyroblast Fluffy_Pillow 44384.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.579 combustion_phase d scorch Fluffy_Pillow 44279.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.473 combustion_phase a pyroblast Fluffy_Pillow 44673.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.184 combustion_phase U fire_blast Fluffy_Pillow 44384.0/50000: 89% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.379 default O rune_of_power Fluffy_Pillow 44079.0/50000: 88% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:14.273 rop_phase g pyroblast Fluffy_Pillow 44973.0/50000: 90% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.168 rop_phase n fireball Fluffy_Pillow 44868.0/50000: 90% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:16.507 rop_phase n fireball Fluffy_Pillow 45207.0/50000: 90% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.849 rop_phase n fireball Fluffy_Pillow 45549.0/50000: 91% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:19.189 rop_phase n fireball Fluffy_Pillow 45889.0/50000: 92% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:20.529 default N use_item_dreadfire_vessel Fluffy_Pillow 46229.0/50000: 92% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:20.529 rop_phase n fireball Fluffy_Pillow 46229.0/50000: 92% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:21.629 rop_phase i fire_blast Fluffy_Pillow 47329.0/50000: 95% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:21.870 rop_phase g pyroblast Fluffy_Pillow 46070.0/50000: 92% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:22.764 rop_phase n fireball Fluffy_Pillow 45964.0/50000: 92% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:24.104 rop_phase n fireball Fluffy_Pillow 46304.0/50000: 93% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:25.444 rop_phase n fireball Fluffy_Pillow 46644.0/50000: 93% mana bloodlust, fireball, rune_of_power
0:26.783 standard_rotation w fireball Fluffy_Pillow 46983.0/50000: 94% mana bloodlust, fireball(2)
0:28.123 standard_rotation w fireball Fluffy_Pillow 47323.0/50000: 95% mana bloodlust, fireball(3)
0:29.464 standard_rotation w fireball Fluffy_Pillow 47664.0/50000: 95% mana bloodlust, fireball(4)
0:30.664 standard_rotation r fire_blast Fluffy_Pillow 48864.0/50000: 98% mana bloodlust, heating_up
0:30.806 standard_rotation p pyroblast Fluffy_Pillow 47506.0/50000: 95% mana bloodlust, hot_streak
0:31.701 standard_rotation w fireball Fluffy_Pillow 47401.0/50000: 95% mana bloodlust, fireball
0:33.042 standard_rotation w fireball Fluffy_Pillow 47742.0/50000: 95% mana bloodlust, fireball
0:34.385 standard_rotation w fireball Fluffy_Pillow 48085.0/50000: 96% mana bloodlust, fireball(2)
0:35.585 standard_rotation r fire_blast Fluffy_Pillow 49285.0/50000: 99% mana bloodlust, heating_up
0:35.727 standard_rotation p pyroblast Fluffy_Pillow 47927.0/50000: 96% mana bloodlust, hot_streak
0:36.622 standard_rotation w fireball Fluffy_Pillow 47822.0/50000: 96% mana bloodlust, fireball
0:37.964 standard_rotation w fireball Fluffy_Pillow 48164.0/50000: 96% mana bloodlust, fireball
0:39.306 standard_rotation w fireball Fluffy_Pillow 48506.0/50000: 97% mana bloodlust, heating_up
0:40.647 standard_rotation w fireball Fluffy_Pillow 48847.0/50000: 98% mana bloodlust, fireball
0:41.988 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
0:43.730 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
0:45.473 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(4)
0:47.213 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(5)
0:48.513 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:48.955 standard_rotation o pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, firestorm
0:50.116 standard_rotation o pyroblast Fluffy_Pillow 49103.0/50000: 98% mana hot_streak, firestorm
0:51.278 standard_rotation o pyroblast Fluffy_Pillow 49265.0/50000: 99% mana heating_up, firestorm
0:52.442 standard_rotation o pyroblast Fluffy_Pillow 49429.0/50000: 99% mana hot_streak, firestorm
0:53.603 standard_rotation w fireball Fluffy_Pillow 49590.0/50000: 99% mana heating_up
0:54.903 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:55.343 standard_rotation p pyroblast Fluffy_Pillow 48940.0/50000: 98% mana hot_streak
0:56.505 standard_rotation w fireball Fluffy_Pillow 49102.0/50000: 98% mana fireball, heating_up
0:58.247 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, heating_up
0:59.988 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:01.728 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
1:03.471 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(4)
1:05.212 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(5)
1:06.612 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:06.955 combustion_phase c fireball Fluffy_Pillow 48843.0/50000: 98% mana hot_streak, firestorm
1:08.255 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak, firestorm
1:08.695 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44440.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, firestorm
1:08.695 combustion_phase Y pyroblast Fluffy_Pillow 44440.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, firestorm, gladiators_badge
1:09.858 combustion_phase Y pyroblast Fluffy_Pillow 44603.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
1:10.658 combustion_phase U fire_blast Fluffy_Pillow 44403.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
1:11.019 combustion_phase Z pyroblast Fluffy_Pillow 44264.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:11.219 combustion_phase U fire_blast Fluffy_Pillow 43464.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:12.181 combustion_phase Z pyroblast Fluffy_Pillow 43926.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:13.345 combustion_phase b phoenix_flames Fluffy_Pillow 44090.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.508 combustion_phase Z pyroblast Fluffy_Pillow 45253.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:14.508 combustion_phase U fire_blast Fluffy_Pillow 44253.0/50000: 89% mana combustion, rune_of_power, gladiators_badge
1:15.670 combustion_phase Z pyroblast Fluffy_Pillow 44915.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:16.832 combustion_phase b phoenix_flames Fluffy_Pillow 45077.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
1:17.995 combustion_phase Z pyroblast Fluffy_Pillow 46240.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:19.156 combustion_phase e dragons_breath Fluffy_Pillow 46401.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:20.318 default O rune_of_power Fluffy_Pillow 45563.0/50000: 91% mana heating_up, gladiators_badge
1:21.481 rop_phase l phoenix_flames Fluffy_Pillow 46726.0/50000: 93% mana heating_up, rune_of_power, gladiators_badge
1:22.641 rop_phase n fireball Fluffy_Pillow 47886.0/50000: 96% mana rune_of_power, gladiators_badge
1:24.383 rop_phase n fireball Fluffy_Pillow 48628.0/50000: 97% mana rune_of_power
1:25.983 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
1:26.125 rop_phase g pyroblast Fluffy_Pillow 48642.0/50000: 97% mana hot_streak, rune_of_power
1:27.287 rop_phase n fireball Fluffy_Pillow 48804.0/50000: 98% mana fireball, rune_of_power
1:29.028 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
1:30.768 rop_phase n fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2), rune_of_power
1:32.509 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3), rune_of_power
1:33.809 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:34.251 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, firestorm
1:35.414 standard_rotation o pyroblast Fluffy_Pillow 49105.0/50000: 98% mana fireball, heating_up, firestorm
1:36.578 standard_rotation o pyroblast Fluffy_Pillow 49269.0/50000: 99% mana fireball, hot_streak, firestorm
1:37.740 standard_rotation o pyroblast Fluffy_Pillow 49431.0/50000: 99% mana fireball, heating_up, firestorm
1:38.902 standard_rotation w fireball Fluffy_Pillow 49593.0/50000: 99% mana fireball, hot_streak, firestorm
1:40.644 standard_rotation o pyroblast Fluffy_Pillow 49005.0/50000: 98% mana fireball, hot_streak, firestorm
1:41.807 standard_rotation o pyroblast Fluffy_Pillow 49168.0/50000: 98% mana fireball(2), heating_up, firestorm
1:42.969 standard_rotation w fireball Fluffy_Pillow 49330.0/50000: 99% mana fireball(2), hot_streak
1:44.710 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), hot_streak
1:45.874 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball(3)
1:47.616 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
1:49.356 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(4)
1:50.656 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:51.099 default N use_item_dreadfire_vessel Fluffy_Pillow 48943.0/50000: 98% mana hot_streak, firestorm
1:51.099 standard_rotation o pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak, firestorm
1:52.260 standard_rotation o pyroblast Fluffy_Pillow 49104.0/50000: 98% mana fireball, heating_up, firestorm
1:53.422 standard_rotation o pyroblast Fluffy_Pillow 49266.0/50000: 99% mana fireball, hot_streak, firestorm
1:54.585 standard_rotation o pyroblast Fluffy_Pillow 49429.0/50000: 99% mana fireball, heating_up, firestorm
1:55.748 standard_rotation w fireball Fluffy_Pillow 49592.0/50000: 99% mana fireball, hot_streak
1:57.490 standard_rotation p pyroblast Fluffy_Pillow 49005.0/50000: 98% mana fireball, hot_streak
1:58.654 standard_rotation w fireball Fluffy_Pillow 49169.0/50000: 98% mana heating_up
1:59.954 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:00.395 default M mirror_image Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
2:01.558 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball, hot_streak
2:03.299 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak
2:04.461 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball(2)
2:06.204 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(2)
2:07.504 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:07.946 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:09.109 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball
2:10.852 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
2:12.152 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:12.594 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, firestorm
2:13.758 standard_rotation o pyroblast Fluffy_Pillow 49106.0/50000: 98% mana fireball, heating_up, firestorm
2:14.920 combustion_phase Y pyroblast Fluffy_Pillow 49268.0/50000: 99% mana fireball, hot_streak, firestorm
2:16.083 combustion_phase Y pyroblast Fluffy_Pillow 49431.0/50000: 99% mana fireball, heating_up, firestorm
2:17.247 combustion_phase c fireball Fluffy_Pillow 49595.0/50000: 99% mana fireball, hot_streak
2:18.547 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
2:18.990 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44443.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power
2:18.990 combustion_phase Z pyroblast Fluffy_Pillow 44443.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, gladiators_badge
2:20.153 combustion_phase Z pyroblast Fluffy_Pillow 44606.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:20.153 combustion_phase U fire_blast Fluffy_Pillow 43606.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
2:21.315 combustion_phase Z pyroblast Fluffy_Pillow 44268.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:21.315 combustion_phase U fire_blast Fluffy_Pillow 43268.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
2:22.477 combustion_phase Z pyroblast Fluffy_Pillow 43930.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.640 combustion_phase b phoenix_flames Fluffy_Pillow 44093.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
2:24.803 combustion_phase Z pyroblast Fluffy_Pillow 45256.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:24.803 combustion_phase U fire_blast Fluffy_Pillow 44256.0/50000: 89% mana combustion, rune_of_power, gladiators_badge
2:25.963 combustion_phase Z pyroblast Fluffy_Pillow 44916.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:27.125 combustion_phase b phoenix_flames Fluffy_Pillow 45078.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
2:28.288 combustion_phase Z pyroblast Fluffy_Pillow 46241.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:29.452 combustion_phase e dragons_breath Fluffy_Pillow 46405.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:30.614 default O rune_of_power Fluffy_Pillow 45567.0/50000: 91% mana heating_up, gladiators_badge
2:31.775 rop_phase n fireball Fluffy_Pillow 46728.0/50000: 93% mana heating_up, rune_of_power, gladiators_badge
2:33.075 rop_phase i fire_blast Fluffy_Pillow 48028.0/50000: 96% mana heating_up, rune_of_power, gladiators_badge
2:33.516 rop_phase g pyroblast Fluffy_Pillow 46969.0/50000: 94% mana hot_streak, rune_of_power, gladiators_badge
2:34.678 rop_phase n fireball Fluffy_Pillow 47131.0/50000: 94% mana fireball, rune_of_power
2:36.421 rop_phase n fireball Fluffy_Pillow 47874.0/50000: 96% mana fireball, rune_of_power
2:38.163 rop_phase n fireball Fluffy_Pillow 48616.0/50000: 97% mana heating_up, rune_of_power
2:39.903 rop_phase g pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak, rune_of_power
2:41.065 rop_phase n fireball Fluffy_Pillow 49165.0/50000: 98% mana fireball, rune_of_power
2:42.809 rop_phase n fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball, rune_of_power
2:44.551 standard_rotation t phoenix_flames Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:45.713 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:47.013 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:47.455 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:48.619 standard_rotation w fireball Fluffy_Pillow 49106.0/50000: 98% mana fireball
2:50.362 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
2:52.104 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:53.844 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
2:55.586 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4)
2:57.327 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(5)
2:59.068 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(6)
3:00.468 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:00.810 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak, firestorm
3:01.971 standard_rotation o pyroblast Fluffy_Pillow 49003.0/50000: 98% mana fireball, heating_up, firestorm
3:03.133 standard_rotation o pyroblast Fluffy_Pillow 49165.0/50000: 98% mana fireball, hot_streak, firestorm
3:04.296 standard_rotation o pyroblast Fluffy_Pillow 49328.0/50000: 99% mana fireball, heating_up, firestorm
3:05.459 standard_rotation w fireball Fluffy_Pillow 49491.0/50000: 99% mana fireball, hot_streak, firestorm
3:07.200 standard_rotation o pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, hot_streak, firestorm
3:08.363 standard_rotation o pyroblast Fluffy_Pillow 49167.0/50000: 98% mana fireball(2), heating_up, firestorm
3:09.526 standard_rotation w fireball Fluffy_Pillow 49330.0/50000: 99% mana fireball(2), hot_streak, firestorm
3:11.268 standard_rotation o pyroblast Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), hot_streak, firestorm
3:12.432 standard_rotation o pyroblast Fluffy_Pillow 49169.0/50000: 98% mana fireball(3), heating_up, firestorm
3:13.595 standard_rotation w fireball Fluffy_Pillow 49332.0/50000: 99% mana fireball(3), hot_streak
3:15.336 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball(3), hot_streak
3:16.498 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball(4), heating_up
3:17.798 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball(4), heating_up
3:18.240 default O rune_of_power Fluffy_Pillow 48942.0/50000: 98% mana fireball(4), hot_streak
3:19.403 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana fireball(5), hot_streak, rune_of_power
3:19.403 rop_phase h fire_blast Fluffy_Pillow 49000.0/50000: 98% mana fireball(5), rune_of_power
3:20.567 rop_phase n fireball Fluffy_Pillow 49664.0/50000: 99% mana fireball(5), hot_streak, rune_of_power
3:22.308 rop_phase g pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball(5), hot_streak, rune_of_power
3:23.471 rop_phase n fireball Fluffy_Pillow 49167.0/50000: 98% mana heating_up, rune_of_power
3:24.771 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
3:25.213 rop_phase g pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak, rune_of_power
3:26.376 rop_phase n fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball, rune_of_power
3:28.119 combustion_phase c fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball, rune_of_power
3:29.419 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(2), rune_of_power
3:29.419 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(2), rune_of_power
3:29.861 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power
3:29.861 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball(2), heating_up, rune_of_power, gladiators_badge
3:31.026 combustion_phase Z pyroblast Fluffy_Pillow 45107.0/50000: 90% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:32.188 combustion_phase Y pyroblast Fluffy_Pillow 45269.0/50000: 91% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:33.350 combustion_phase Y pyroblast Fluffy_Pillow 45431.0/50000: 91% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:34.513 combustion_phase U fire_blast Fluffy_Pillow 45594.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
3:34.513 combustion_phase Z pyroblast Fluffy_Pillow 45094.0/50000: 90% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:35.675 combustion_phase Y pyroblast Fluffy_Pillow 45256.0/50000: 91% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:36.837 combustion_phase Y pyroblast Fluffy_Pillow 45418.0/50000: 91% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:38.001 combustion_phase Y pyroblast Fluffy_Pillow 45582.0/50000: 91% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:39.163 combustion_phase Z pyroblast Fluffy_Pillow 45744.0/50000: 91% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:40.327 combustion_phase Y pyroblast Fluffy_Pillow 45908.0/50000: 92% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:41.488 standard_rotation o pyroblast Fluffy_Pillow 46069.0/50000: 92% mana hot_streak, firestorm, gladiators_badge
3:42.650 standard_rotation o pyroblast Fluffy_Pillow 46231.0/50000: 92% mana heating_up, firestorm, gladiators_badge
3:43.812 standard_rotation t phoenix_flames Fluffy_Pillow 46393.0/50000: 93% mana hot_streak, gladiators_badge
3:44.975 standard_rotation q pyroblast Fluffy_Pillow 47556.0/50000: 95% mana hot_streak
3:46.137 standard_rotation v scorch Fluffy_Pillow 47718.0/50000: 95% mana
3:46.137 standard_rotation r fire_blast Fluffy_Pillow 47718.0/50000: 95% mana
3:47.301 standard_rotation s pyroblast Fluffy_Pillow 47882.0/50000: 96% mana heating_up
3:48.473 standard_rotation o pyroblast Fluffy_Pillow 48054.0/50000: 96% mana heating_up, firestorm
3:48.683 standard_rotation r fire_blast Fluffy_Pillow 47254.0/50000: 95% mana heating_up, firestorm
3:49.634 standard_rotation o pyroblast Fluffy_Pillow 47715.0/50000: 95% mana hot_streak, firestorm
3:50.797 default N use_item_dreadfire_vessel Fluffy_Pillow 47878.0/50000: 96% mana heating_up, firestorm
3:50.797 standard_rotation o pyroblast Fluffy_Pillow 47878.0/50000: 96% mana heating_up, firestorm
3:51.959 standard_rotation q pyroblast Fluffy_Pillow 48040.0/50000: 96% mana hot_streak
3:53.121 standard_rotation t phoenix_flames Fluffy_Pillow 48202.0/50000: 96% mana heating_up
3:54.285 standard_rotation v scorch Fluffy_Pillow 49366.0/50000: 99% mana
3:55.448 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
3:56.611 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
3:56.611 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
3:57.775 standard_rotation v scorch Fluffy_Pillow 49169.0/50000: 98% mana
3:58.939 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
4:00.102 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:01.274 default M mirror_image Fluffy_Pillow 49677.0/50000: 99% mana
4:02.437 standard_rotation v scorch Fluffy_Pillow 49840.0/50000: 100% mana
4:03.600 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:04.763 default O rune_of_power Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:04.763 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:05.926 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power
4:07.089 rop_phase m scorch Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
4:08.250 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
4:09.425 rop_phase m scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, rune_of_power, firestorm
4:10.588 rop_phase f pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power, firestorm
4:11.750 rop_phase f pyroblast Fluffy_Pillow 49667.0/50000: 99% mana hot_streak, rune_of_power, firestorm
4:11.846 rop_phase h fire_blast Fluffy_Pillow 48667.0/50000: 97% mana rune_of_power, firestorm
4:12.913 rop_phase g pyroblast Fluffy_Pillow 49330.0/50000: 99% mana hot_streak, rune_of_power
4:14.077 rop_phase m scorch Fluffy_Pillow 49494.0/50000: 99% mana rune_of_power
4:15.241 rop_phase m scorch Fluffy_Pillow 49506.0/50000: 99% mana rune_of_power
4:16.404 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
4:17.576 rop_phase m scorch Fluffy_Pillow 49677.0/50000: 99% mana rune_of_power
4:18.739 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:19.902 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:19.902 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
4:21.065 standard_rotation v scorch Fluffy_Pillow 49168.0/50000: 98% mana
4:22.229 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
4:23.392 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:24.565 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:25.727 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:26.891 standard_rotation s pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up
4:28.063 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:29.226 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:30.388 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:31.563 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:32.726 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:33.888 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:35.060 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana
4:36.221 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:37.384 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:38.557 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up, firestorm
4:39.719 standard_rotation o pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, firestorm
4:40.882 combustion_phase Y pyroblast Fluffy_Pillow 49667.0/50000: 99% mana hot_streak, firestorm
4:42.042 combustion_phase c fireball Fluffy_Pillow 49827.0/50000: 100% mana heating_up
4:43.342 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:43.342 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, heating_up, rune_of_power
4:43.785 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43943.0/50000: 88% mana combustion, hot_streak, rune_of_power
4:43.785 combustion_phase Z pyroblast Fluffy_Pillow 43943.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:44.946 combustion_phase Z pyroblast Fluffy_Pillow 44104.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:44.946 combustion_phase U fire_blast Fluffy_Pillow 43104.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
4:46.108 combustion_phase Z pyroblast Fluffy_Pillow 43766.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:46.108 combustion_phase U fire_blast Fluffy_Pillow 42766.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
4:47.271 combustion_phase Z pyroblast Fluffy_Pillow 43429.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:48.434 combustion_phase b phoenix_flames Fluffy_Pillow 43592.0/50000: 87% mana combustion, heating_up, rune_of_power, gladiators_badge
4:49.597 combustion_phase Z pyroblast Fluffy_Pillow 44755.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:50.760 combustion_phase b phoenix_flames Fluffy_Pillow 44918.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
4:51.923 combustion_phase Z pyroblast Fluffy_Pillow 46081.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:51.923 combustion_phase U fire_blast Fluffy_Pillow 45081.0/50000: 90% mana combustion, rune_of_power, gladiators_badge
4:53.084 combustion_phase Z pyroblast Fluffy_Pillow 45742.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:54.248 combustion_phase e dragons_breath Fluffy_Pillow 45906.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.409 default O rune_of_power Fluffy_Pillow 45067.0/50000: 90% mana heating_up, gladiators_badge
4:56.571 rop_phase m scorch Fluffy_Pillow 46229.0/50000: 92% mana heating_up, rune_of_power, gladiators_badge
4:57.733 rop_phase k pyroblast Fluffy_Pillow 46891.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
4:58.785 rop_phase h fire_blast Fluffy_Pillow 46902.0/50000: 94% mana rune_of_power
4:58.905 rop_phase m scorch Fluffy_Pillow 46563.0/50000: 93% mana heating_up, rune_of_power
5:00.068 rop_phase k pyroblast Fluffy_Pillow 47226.0/50000: 94% mana heating_up, rune_of_power
5:01.240 rop_phase m scorch Fluffy_Pillow 47398.0/50000: 95% mana rune_of_power
5:02.402 rop_phase m scorch Fluffy_Pillow 48060.0/50000: 96% mana rune_of_power
5:03.563 rop_phase k pyroblast Fluffy_Pillow 48721.0/50000: 97% mana heating_up, rune_of_power
5:04.738 rop_phase m scorch Fluffy_Pillow 48896.0/50000: 98% mana rune_of_power
5:05.901 rop_phase m scorch Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power
5:07.063 rop_phase i fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:07.063 rop_phase g pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, rune_of_power
5:08.225 rop_phase m scorch Fluffy_Pillow 49166.0/50000: 98% mana hot_streak, rune_of_power
5:09.387 standard_rotation q pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak
5:10.550 standard_rotation t phoenix_flames Fluffy_Pillow 49667.0/50000: 99% mana hot_streak
5:11.712 standard_rotation q pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
5:12.874 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana heating_up
5:14.035 standard_rotation r fire_blast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
5:14.227 standard_rotation q pyroblast Fluffy_Pillow 49195.0/50000: 98% mana hot_streak
5:15.391 standard_rotation v scorch Fluffy_Pillow 49359.0/50000: 99% mana
5:16.554 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
5:17.717 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
5:18.889 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana

Stats

Level Bonus (60) Race Bonus (pandaren) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 -2 304 304 0
Stamina 414 2 2020 1924 1508
Intellect 450 0 1838 1635 1108 (132)
Spirit 0 0 0 0 0
Health 40400 38480 0
Mana 50000 50000 0
Spell Power 1838 1635 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="pandaren"
source=default
spec=fire
level=60
race=pandaren
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

void_elf : 5118 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5118.4 5118.4 9.8 / 0.192% 803.2 / 15.7% 6.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
798.3 793.5 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
void_elf 5118
Conflagration Flare Up 23 0.5% 29.8 9.75sec 236 0 Direct 29.8 150 376 236 38.2%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.81 29.81 0.00 0.00 0.0000 0.0000 7044.14 7044.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.85% 18.44 4 36 150.10 130 255 150.14 131 176 2767 2767 0.00%
crit 38.15% 11.37 1 23 376.17 260 510 376.29 260 488 4277 4277 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 10 0.2% 0.8 103.05sec 3905 3362 Direct 0.8 0 3905 3905 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.77 0.77 0.00 0.00 1.1625 0.0000 3022.83 3022.83 0.00% 3362.43 3362.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.77 0 4 3904.66 3791 4401 2243.54 0 4401 3023 3023 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.77
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 158 3.1% 3.3 103.70sec 14392 0 Direct 3.3 11653 23291 14452 24.0%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.29 0.00 0.00 0.0000 0.0000 47509.77 47509.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.96% 2.50 0 4 11652.85 11342 12023 11552.53 0 12023 29102 29102 0.00%
crit 24.04% 0.79 0 3 23291.13 22685 24046 13833.94 0 24046 18408 18408 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Entropic Embrace 63 1.2% 194.4 1.49sec 97 0 Direct 194.3 97 0 97 0.0%

Stats Details: Entropic Embrace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 194.38 194.26 0.00 0.00 0.0000 0.0000 18784.43 18784.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 194.26 135 235 96.71 1 1338 96.86 73 126 18784 18784 0.00%

Action Details: Entropic Embrace

  • id:259756
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:44.62
  • base_dd_max:44.62
  • base_dd_mult:1.00

Spelldata

  • id:259756
  • name:Entropic Embrace
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc256374={$@spelldesc255669=Your abilities have a chance to empower you with the essence of the Void, causing your damage and healing effects to deal an additional {$256374s1=5}% as Shadowfrost for {$256374d=12 seconds}.}}
Fire Blast 600 11.7% 42.3 7.15sec 4257 0 Direct 42.3 0 4257 4257 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.30 42.30 0.00 0.00 0.0000 0.0000 180053.43 180053.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.30 33 50 4256.63 3050 5984 4258.34 4021 4518 180053 180053 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.62
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:3.03
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.33
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.32
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 613 (641) 12.0% (12.5%) 77.3 3.42sec 2486 1495 Direct 77.3 (220.8) 1659 3451 2377 40.1% (40.1%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.33 77.32 0.00 0.00 1.6624 0.0000 183811.44 183811.44 0.00% 1495.47 1495.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.91% 46.33 24 68 1658.54 1439 2579 1658.88 1527 1784 76837 76837 0.00%
crit 40.09% 31.00 18 45 3450.76 2879 5648 3454.14 3245 3708 106975 106975 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.70
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.91
    standard_rotation
    [w]:51.76
    Conflagration 28 0.5% 77.3 3.41sec 109 0 Periodic 143.4 36 90 59 42.7% 69.1%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.32 0.00 143.44 143.44 0.0000 1.4473 8441.78 8441.78 0.00% 40.67 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 57.34% 82.24 54 109 35.57 0 57 35.57 33 38 2925 2925 0.00%
crit 42.66% 61.19 42 89 90.15 0 125 90.24 83 98 5517 5517 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 956 18.7% 264.7 1.13sec 1085 0 Periodic 299.2 960 0 960 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.71 0.00 299.20 299.20 0.0000 1.0000 287120.27 287120.27 0.00% 959.62 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 959.72 152 2877 960.48 832 1137 287120 287120 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.47sec 3660 4733

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7736 0.0000 0.00 0.00 0.00% 4733.07 4733.07

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 97  / 37 0.7% 236.0 3.45sec 46 33 Direct 235.3 37 75 47 24.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.97 235.25 0.00 0.00 1.3988 0.0000 10942.86 10942.86 0.00% 33.15 33.15
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.59% 177.82 112 210 37.38 29 53 37.46 35 41 6647 6647 0.00%
crit 24.41% 57.43 31 81 74.80 57 106 74.96 63 87 4296 4296 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.69
Phoenix Flames 0 (243) 0.0% (4.7%) 14.1 21.68sec 5149 4678

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.12 0.00 0.00 0.00 1.1008 0.0000 0.00 0.00 0.00% 4677.63 4677.63

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.12
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.32
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.68
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 243 4.7% 14.1 21.68sec 5163 0 Direct 14.1 2101 5990 5165 78.8%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.08 14.08 0.00 0.00 0.0000 0.0000 72718.50 72718.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.24% 2.99 0 9 2100.87 1733 3400 2063.29 0 3400 6283 6283 0.00%
crit 78.76% 11.09 5 16 5989.93 3466 6800 5995.75 5278 6383 66435 66435 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2045 (2176) 40.0% (42.5%) 96.7 3.08sec 6759 6047 Direct 97.4 (275.3) 3093 7759 6308 68.9% (68.9%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 96.66 97.36 0.00 0.00 1.1178 0.0000 614049.22 614049.22 0.00% 6046.96 6046.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 31.11% 30.29 17 46 3093.11 2624 5149 3093.50 2795 3469 93696 93696 0.00%
crit 68.89% 67.07 39 106 7758.85 5249 10299 7785.70 7018 8807 520353 520353 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.24
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.38
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.23
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.82
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.44
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.44
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.72
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.45
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.23
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.75
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 131 2.6% 97.4 3.07sec 403 0 Periodic 178.0 136 349 221 39.6% 86.6%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.36 0.00 177.97 177.97 0.0000 1.4625 39258.00 39258.00 0.00% 150.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 60.39% 107.47 70 145 136.43 5 234 136.45 128 144 14663 14663 0.00%
crit 39.61% 70.49 48 97 348.93 10 468 349.33 324 377 24595 24595 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 211 4.1% 33.7 7.52sec 1889 1638 Direct 33.7 0 1890 1890 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.68 33.68 0.00 0.00 1.1530 0.0000 63625.41 63625.41 0.00% 1638.35 1638.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.68 17 52 1889.63 1152 3344 1890.10 1682 2131 63625 63625 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.68
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:8.07
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.30
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
void_elf
Combustion 4.7 70.39sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.68
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:void_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:void_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.20
Rune of Power 5.3 60.00sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 1.1122 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.36
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.7sec 70.7sec 11.8sec 18.41% 0.00% 105.8 (105.8) 4.5

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:52.4s / 87.8s
  • trigger_min/max:52.4s / 87.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.41%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Entropic Embrace 5.4 0.0 60.7sec 60.7sec 11.8sec 21.32% 0.00% 0.0 (0.0) 5.2

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_entropic_embrace
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 67.6s
  • trigger_min/max:60.0s / 67.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • entropic_embrace_1:21.32%

Spelldata

  • id:256374
  • name:Entropic Embrace
  • tooltip:Your damage and healing effects deal an additional $w1% as Shadowfrost.
  • description:{$@spelldesc255669=Your abilities have a chance to empower you with the essence of the Void, causing your damage and healing effects to deal an additional {$256374s1=5}% as Shadowfrost for {$256374d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Fireball 21.4 24.9 9.2sec 4.2sec 5.1sec 36.69% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 46.0s
  • trigger_min/max:1.3s / 41.3s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 31.8s

Stack Uptimes

  • fireball_1:20.32%
  • fireball_2:9.00%
  • fireball_3:4.46%
  • fireball_4:1.99%
  • fireball_5:0.71%
  • fireball_6:0.19%
  • fireball_7:0.03%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.8 36.4sec 32.4sec 4.2sec 10.96% 0.00% 0.8 (0.8) 7.7

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 157.2s
  • trigger_min/max:0.8s / 157.2s
  • trigger_pct:10.15%
  • duration_min/max:0.1s / 14.9s

Stack Uptimes

  • firestorm_1:10.96%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 71.2sec 72.8sec 14.7sec 22.92% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 87.8s
  • trigger_min/max:60.0s / 87.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.92%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.2 0.0 3.1sec 3.1sec 1.1sec 35.08% 46.74% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 18.6s
  • trigger_min/max:0.2s / 18.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.1s

Stack Uptimes

  • heating_up_1:35.08%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.4 0.0 3.6sec 3.6sec 0.6sec 13.12% 86.52% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.5s / 29.1s
  • trigger_min/max:0.5s / 29.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.8s

Stack Uptimes

  • hot_streak_1:13.12%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 309.6sec 0.0sec 23.5sec 9.38% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.2s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.38%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.7sec 31.0sec 12.0sec 39.03% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 74.6s
  • trigger_min/max:2.5s / 74.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • rune_of_power_1:39.03%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.2 72.0 127.0 3.1s 0.2s 18.6s
Heating Up removed 11.3 2.0 23.0 23.8s 0.9s 226.8s
Heating Up converted with Fire Blast 23.5 14.0 35.0 12.0s 0.5s 126.8s
Hot Streak procs 84.4 61.0 113.0 3.6s 0.5s 29.1s
Hot Streak spells used 264.7 210.0 321.0 1.1s 0.0s 5.2s
Hot Streak spell crits 185.1 137.0 240.0 1.6s 0.0s 17.3s
Hot Streak spell crits wasted 4.6 0.0 12.0 65.7s 0.1s 342.2s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 14.79% 10.27% 19.22% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3290.00012.8500.9840.00012.850
Rune of Power13.6150.00042.83874.56515.548129.324
Fire Blast0.0960.00016.0094.0641.30028.129
Dragon's Breath141.40545.338351.273286.949191.485359.673
Combustion2.2151.30014.40010.4295.52425.837
Phoenix Flames0.2070.00026.7752.9431.73726.885

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
void_elf
mana_regen Mana 2302.62 238463.23 100.00% 103.56 61717.42 20.56%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 793.55 798.33 61742.0 48562.1 42427.0 50000.0
Usage Type Count Total Avg RPE APR
void_elf
combustion Mana 4.7 23378.5 5000.0 5002.6 0.0
dragons_breath Mana 0.8 1549.9 2000.0 2002.4 2.0
fire_blast Mana 42.3 21149.5 500.0 500.0 8.5
fireball Mana 77.3 77336.4 1000.0 1000.1 2.5
mirror_image Mana 3.0 1989.6 665.5 665.5 5.5
pyroblast Mana 97.7 97678.6 1000.0 1010.6 6.7
scorch Mana 33.7 16826.0 500.0 499.5 3.8

Statistics & Data Analysis

Fight Length
void_elf Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
void_elf Damage Per Second
Count 1717
Mean 5118.39
Minimum 4579.05
Maximum 5871.77
Spread ( max - min ) 1292.72
Range [ ( max - min ) / 2 * 100% ] 12.63%
Standard Deviation 207.7748
5th Percentile 4797.09
95th Percentile 5480.79
( 95th Percentile - 5th Percentile ) 683.70
Mean Distribution
Standard Deviation 5.0143
95.00% Confidence Interval ( 5108.56 - 5128.22 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6331
0.1 Scale Factor Error with Delta=300 369
0.05 Scale Factor Error with Delta=300 1475
0.01 Scale Factor Error with Delta=300 36853
Priority Target DPS
void_elf Priority Target Damage Per Second
Count 1717
Mean 5118.39
Minimum 4579.05
Maximum 5871.77
Spread ( max - min ) 1292.72
Range [ ( max - min ) / 2 * 100% ] 12.63%
Standard Deviation 207.7748
5th Percentile 4797.09
95th Percentile 5480.79
( 95th Percentile - 5th Percentile ) 683.70
Mean Distribution
Standard Deviation 5.0143
95.00% Confidence Interval ( 5108.56 - 5128.22 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6331
0.1 Scale Factor Error with Delta=300 369
0.05 Scale Factor Error with Delta=300 1475
0.01 Scale Factor Error with Delta=300 36853
DPS(e)
void_elf Damage Per Second (Effective)
Count 1717
Mean 5118.39
Minimum 4579.05
Maximum 5871.77
Spread ( max - min ) 1292.72
Range [ ( max - min ) / 2 * 100% ] 12.63%
Damage
void_elf Damage
Count 1717
Mean 1525439.23
Minimum 1167315.89
Maximum 1989954.01
Spread ( max - min ) 822638.12
Range [ ( max - min ) / 2 * 100% ] 26.96%
DTPS
void_elf Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
void_elf Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
void_elf Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
void_elf Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
void_elf Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
void_elf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
void_elfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
void_elf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.30 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.36 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.20 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.67 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.62 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.68 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.24 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.38 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.23 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.12 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.70 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.68 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.77 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.82 pyroblast,if=buff.firestorm.react
g 9.44 pyroblast,if=buff.hot_streak.react
h 3.03 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.33 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.44 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.32 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 8.07 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.91 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.72 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.45 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.23 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.32 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.75 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.68 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.30 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.76 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUZUYYYYZUZbZbZUOgnnnnNnnnnhigoooowpwwwwwwwwrpwwwrpwwwwrpooocWTZZUZUZUZbZbZUZOlnnignnnnrpwwwwpwrpwwrpwwwNwwrpwwMwpwwwwwwwcWUTbZUZUZbZdUYYYOgnnnnnnhnrptwwrpwwwwrpwwwrpwwwpwwrpwwwwwwwwYYYcWUTZYYYUZUZbZUZbOgmhkmmkmNmkhfMoqtvvrqvvsvvrqvqvvsvrsvvsvvrqvvsvvsOhmkmmkfiffYcWTbZUZbZdadSaUYootvvrqvvsvvsvrsv

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask void_elf 50000.0/50000: 100% mana
Pre precombat 1 food void_elf 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.742 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:02.635 combustion_phase Z pyroblast Fluffy_Pillow 44835.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:02.635 combustion_phase U fire_blast Fluffy_Pillow 43835.0/50000: 88% mana bloodlust, combustion, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase Z pyroblast Fluffy_Pillow 44231.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:03.531 combustion_phase U fire_blast Fluffy_Pillow 43231.0/50000: 86% mana bloodlust, combustion, rune_of_power, firestorm, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:04.423 combustion_phase Y pyroblast Fluffy_Pillow 43623.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:05.317 combustion_phase Y pyroblast Fluffy_Pillow 43517.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:06.214 combustion_phase Y pyroblast Fluffy_Pillow 43414.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, firestorm, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:07.109 combustion_phase Y pyroblast Fluffy_Pillow 43309.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, firestorm, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:08.003 combustion_phase Z pyroblast Fluffy_Pillow 43203.0/50000: 86% mana bloodlust, combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:08.003 combustion_phase U fire_blast Fluffy_Pillow 42203.0/50000: 84% mana bloodlust, combustion, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:08.896 combustion_phase Z pyroblast Fluffy_Pillow 42596.0/50000: 85% mana bloodlust, combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:09.789 combustion_phase b phoenix_flames Fluffy_Pillow 42489.0/50000: 85% mana bloodlust, combustion, heating_up, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:10.681 combustion_phase Z pyroblast Fluffy_Pillow 43381.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:11.577 combustion_phase b phoenix_flames Fluffy_Pillow 43277.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:12.470 combustion_phase Z pyroblast Fluffy_Pillow 44170.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:13.270 combustion_phase U fire_blast Fluffy_Pillow 43970.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:13.366 default O rune_of_power Fluffy_Pillow 43566.0/50000: 87% mana bloodlust, hot_streak, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
0:14.260 rop_phase g pyroblast Fluffy_Pillow 44460.0/50000: 89% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.156 rop_phase n fireball Fluffy_Pillow 44356.0/50000: 89% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:16.498 rop_phase n fireball Fluffy_Pillow 44698.0/50000: 89% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:17.839 rop_phase n fireball Fluffy_Pillow 45039.0/50000: 90% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:19.181 rop_phase n fireball Fluffy_Pillow 45381.0/50000: 91% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:20.522 default N use_item_dreadfire_vessel Fluffy_Pillow 45722.0/50000: 91% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:20.522 rop_phase n fireball Fluffy_Pillow 45722.0/50000: 91% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:21.861 rop_phase n fireball Fluffy_Pillow 46061.0/50000: 92% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:23.201 rop_phase n fireball Fluffy_Pillow 46401.0/50000: 93% mana bloodlust, fireball, rune_of_power, potion_of_spectral_intellect
0:24.542 rop_phase n fireball Fluffy_Pillow 46742.0/50000: 93% mana bloodlust, fireball(2), rune_of_power, potion_of_spectral_intellect
0:25.142 rop_phase h fire_blast Fluffy_Pillow 47342.0/50000: 95% mana bloodlust, fireball(2), rune_of_power
0:25.642 rop_phase i fire_blast Fluffy_Pillow 47342.0/50000: 95% mana bloodlust, fireball(3), heating_up, rune_of_power
0:25.883 rop_phase g pyroblast Fluffy_Pillow 46083.0/50000: 92% mana bloodlust, fireball(3), hot_streak, rune_of_power, firestorm
0:26.777 standard_rotation o pyroblast Fluffy_Pillow 45977.0/50000: 92% mana bloodlust, hot_streak, firestorm
0:27.671 standard_rotation o pyroblast Fluffy_Pillow 45871.0/50000: 92% mana bloodlust, heating_up, firestorm
0:28.566 standard_rotation o pyroblast Fluffy_Pillow 45766.0/50000: 92% mana bloodlust, hot_streak, firestorm
0:29.460 standard_rotation o pyroblast Fluffy_Pillow 45660.0/50000: 91% mana bloodlust, heating_up, firestorm
0:30.353 standard_rotation w fireball Fluffy_Pillow 45553.0/50000: 91% mana bloodlust, hot_streak
0:31.693 standard_rotation p pyroblast Fluffy_Pillow 45893.0/50000: 92% mana bloodlust, hot_streak
0:32.589 standard_rotation w fireball Fluffy_Pillow 45789.0/50000: 92% mana bloodlust, fireball
0:33.930 standard_rotation w fireball Fluffy_Pillow 46130.0/50000: 92% mana bloodlust, fireball
0:35.270 standard_rotation w fireball Fluffy_Pillow 46470.0/50000: 93% mana bloodlust, fireball(2)
0:36.610 standard_rotation w fireball Fluffy_Pillow 46810.0/50000: 94% mana bloodlust, fireball(3)
0:37.949 standard_rotation w fireball Fluffy_Pillow 47149.0/50000: 94% mana bloodlust, fireball(4)
0:39.289 standard_rotation w fireball Fluffy_Pillow 47489.0/50000: 95% mana bloodlust, fireball(5)
0:40.630 standard_rotation w fireball Fluffy_Pillow 47830.0/50000: 96% mana bloodlust, fireball(6)
0:41.972 standard_rotation w fireball Fluffy_Pillow 48172.0/50000: 96% mana fireball(7)
0:43.272 standard_rotation r fire_blast Fluffy_Pillow 49472.0/50000: 99% mana heating_up
0:43.714 standard_rotation p pyroblast Fluffy_Pillow 48414.0/50000: 97% mana hot_streak
0:44.876 standard_rotation w fireball Fluffy_Pillow 48576.0/50000: 97% mana fireball
0:46.618 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
0:48.360 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
0:49.660 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:50.102 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
0:51.264 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
0:53.005 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
0:54.746 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
0:56.486 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3)
0:57.886 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:58.226 standard_rotation p pyroblast Fluffy_Pillow 48840.0/50000: 98% mana hot_streak, firestorm
0:59.388 standard_rotation o pyroblast Fluffy_Pillow 49002.0/50000: 98% mana fireball, heating_up, firestorm
1:00.550 standard_rotation o pyroblast Fluffy_Pillow 49164.0/50000: 98% mana fireball, hot_streak, firestorm
1:01.712 standard_rotation o pyroblast Fluffy_Pillow 49326.0/50000: 99% mana fireball, heating_up, firestorm
1:02.876 combustion_phase c fireball Fluffy_Pillow 49490.0/50000: 99% mana fireball, hot_streak, entropic_embrace
1:04.176 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak, entropic_embrace
1:04.617 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44441.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, entropic_embrace
1:04.617 combustion_phase Z pyroblast Fluffy_Pillow 44441.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, entropic_embrace, gladiators_badge
1:05.778 combustion_phase Z pyroblast Fluffy_Pillow 44602.0/50000: 89% mana combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge
1:05.778 combustion_phase U fire_blast Fluffy_Pillow 43602.0/50000: 87% mana combustion, rune_of_power, entropic_embrace, gladiators_badge
1:06.939 combustion_phase Z pyroblast Fluffy_Pillow 44263.0/50000: 89% mana combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge
1:06.939 combustion_phase U fire_blast Fluffy_Pillow 43263.0/50000: 87% mana combustion, rune_of_power, entropic_embrace, gladiators_badge
1:08.102 combustion_phase Z pyroblast Fluffy_Pillow 43926.0/50000: 88% mana combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge
1:08.102 combustion_phase U fire_blast Fluffy_Pillow 42926.0/50000: 86% mana combustion, rune_of_power, entropic_embrace, gladiators_badge
1:09.263 combustion_phase Z pyroblast Fluffy_Pillow 43587.0/50000: 87% mana combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge
1:10.426 combustion_phase b phoenix_flames Fluffy_Pillow 43750.0/50000: 88% mana combustion, heating_up, rune_of_power, entropic_embrace, gladiators_badge
1:11.587 combustion_phase Z pyroblast Fluffy_Pillow 44911.0/50000: 90% mana combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge
1:12.748 combustion_phase b phoenix_flames Fluffy_Pillow 45072.0/50000: 90% mana combustion, heating_up, rune_of_power, entropic_embrace, gladiators_badge
1:13.911 combustion_phase Z pyroblast Fluffy_Pillow 46235.0/50000: 92% mana combustion, hot_streak, rune_of_power, entropic_embrace, gladiators_badge
1:14.411 combustion_phase U fire_blast Fluffy_Pillow 45735.0/50000: 91% mana combustion, rune_of_power, entropic_embrace, gladiators_badge
1:15.075 combustion_phase Z pyroblast Fluffy_Pillow 45899.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:16.238 default O rune_of_power Fluffy_Pillow 46062.0/50000: 92% mana heating_up, gladiators_badge
1:17.400 rop_phase l phoenix_flames Fluffy_Pillow 47224.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
1:18.562 rop_phase n fireball Fluffy_Pillow 48386.0/50000: 97% mana rune_of_power, gladiators_badge
1:20.304 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana rune_of_power
1:22.040 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
1:22.044 rop_phase g pyroblast Fluffy_Pillow 48504.0/50000: 97% mana hot_streak, rune_of_power
1:23.204 rop_phase n fireball Fluffy_Pillow 48664.0/50000: 97% mana fireball, rune_of_power
1:24.946 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
1:26.690 rop_phase n fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball(2), rune_of_power
1:28.432 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), rune_of_power
1:29.761 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:30.174 standard_rotation p pyroblast Fluffy_Pillow 48913.0/50000: 98% mana hot_streak
1:31.337 standard_rotation w fireball Fluffy_Pillow 49076.0/50000: 98% mana fireball
1:33.078 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:34.820 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:36.562 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
1:38.303 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
1:39.467 standard_rotation w fireball Fluffy_Pillow 49168.0/50000: 98% mana fireball, heating_up
1:40.767 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
1:41.209 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana fireball, hot_streak
1:42.371 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball(2)
1:44.111 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
1:45.611 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:45.853 standard_rotation p pyroblast Fluffy_Pillow 48742.0/50000: 97% mana hot_streak
1:47.014 standard_rotation w fireball Fluffy_Pillow 48903.0/50000: 98% mana fireball
1:48.756 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:50.498 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
1:52.240 default N use_item_dreadfire_vessel Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:52.240 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:53.980 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
1:55.280 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:55.721 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:56.883 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball
1:58.624 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:00.363 default M mirror_image Fluffy_Pillow 49002.0/50000: 98% mana heating_up
2:01.524 standard_rotation w fireball Fluffy_Pillow 49163.0/50000: 98% mana hot_streak
2:03.265 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, entropic_embrace
2:04.430 standard_rotation w fireball Fluffy_Pillow 49169.0/50000: 98% mana heating_up, entropic_embrace
2:06.172 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up, entropic_embrace
2:07.913 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, entropic_embrace
2:09.655 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), entropic_embrace
2:11.396 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up, entropic_embrace
2:13.138 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, entropic_embrace
2:14.880 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:16.622 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
2:17.922 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball(4)
2:17.922 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball(4), rune_of_power
2:18.364 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball(4), heating_up, rune_of_power
2:18.364 combustion_phase b phoenix_flames Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball(4), heating_up, rune_of_power, gladiators_badge
2:19.526 combustion_phase Z pyroblast Fluffy_Pillow 45104.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:19.526 combustion_phase U fire_blast Fluffy_Pillow 44104.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:20.690 combustion_phase Z pyroblast Fluffy_Pillow 44768.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:20.690 combustion_phase U fire_blast Fluffy_Pillow 43768.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
2:21.853 combustion_phase Z pyroblast Fluffy_Pillow 44431.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.016 combustion_phase b phoenix_flames Fluffy_Pillow 44594.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
2:24.178 combustion_phase Z pyroblast Fluffy_Pillow 45756.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:25.340 combustion_phase d scorch Fluffy_Pillow 45918.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:25.740 combustion_phase U fire_blast Fluffy_Pillow 46318.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
2:26.503 combustion_phase Y pyroblast Fluffy_Pillow 46081.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:27.665 combustion_phase Y pyroblast Fluffy_Pillow 46243.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:28.827 combustion_phase Y pyroblast Fluffy_Pillow 46405.0/50000: 93% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
2:29.989 default O rune_of_power Fluffy_Pillow 46567.0/50000: 93% mana hot_streak, gladiators_badge
2:31.150 rop_phase g pyroblast Fluffy_Pillow 47728.0/50000: 95% mana hot_streak, rune_of_power, gladiators_badge
2:32.313 rop_phase n fireball Fluffy_Pillow 47891.0/50000: 96% mana rune_of_power, gladiators_badge
2:34.053 rop_phase n fireball Fluffy_Pillow 48631.0/50000: 97% mana rune_of_power
2:35.794 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
2:37.534 rop_phase n fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2), rune_of_power
2:39.276 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3), rune_of_power
2:41.018 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4), rune_of_power
2:41.118 rop_phase h fire_blast Fluffy_Pillow 49105.0/50000: 98% mana fireball(4), rune_of_power
2:42.760 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(5), rune_of_power
2:44.060 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:44.501 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
2:45.663 standard_rotation t phoenix_flames Fluffy_Pillow 49103.0/50000: 98% mana fireball
2:46.824 standard_rotation w fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball
2:48.566 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
2:49.866 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:50.307 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
2:51.469 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana heating_up
2:53.210 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
2:54.951 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
2:56.691 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
2:58.191 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:58.432 standard_rotation p pyroblast Fluffy_Pillow 48741.0/50000: 97% mana hot_streak
2:59.593 standard_rotation w fireball Fluffy_Pillow 48902.0/50000: 98% mana heating_up
3:01.335 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
3:03.077 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:04.377 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, entropic_embrace
3:04.820 standard_rotation p pyroblast Fluffy_Pillow 48943.0/50000: 98% mana hot_streak, entropic_embrace
3:05.982 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball, entropic_embrace
3:07.722 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball, entropic_embrace
3:09.464 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up, entropic_embrace
3:11.205 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, entropic_embrace
3:12.367 standard_rotation w fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball, entropic_embrace
3:14.109 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, entropic_embrace
3:15.409 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, entropic_embrace
3:15.850 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
3:17.013 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
3:18.754 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
3:20.494 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2)
3:22.236 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
3:23.977 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:25.719 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:27.460 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:29.201 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:30.943 combustion_phase Y pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak, firestorm
3:32.105 combustion_phase Y pyroblast Fluffy_Pillow 49167.0/50000: 98% mana fireball, heating_up, firestorm
3:33.265 combustion_phase Y pyroblast Fluffy_Pillow 49327.0/50000: 99% mana fireball, hot_streak, firestorm
3:34.428 combustion_phase c fireball Fluffy_Pillow 49490.0/50000: 99% mana fireball, heating_up
3:35.728 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
3:35.728 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, heating_up, rune_of_power
3:36.170 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball, hot_streak, rune_of_power, firestorm
3:36.170 combustion_phase Z pyroblast Fluffy_Pillow 43942.0/50000: 88% mana combustion, fireball, hot_streak, rune_of_power, firestorm, gladiators_badge
3:37.331 combustion_phase Y pyroblast Fluffy_Pillow 44103.0/50000: 88% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:38.494 combustion_phase Y pyroblast Fluffy_Pillow 44266.0/50000: 89% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
3:39.657 combustion_phase Y pyroblast Fluffy_Pillow 44429.0/50000: 89% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
3:39.757 combustion_phase U fire_blast Fluffy_Pillow 43529.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
3:40.820 combustion_phase Z pyroblast Fluffy_Pillow 44092.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:40.820 combustion_phase U fire_blast Fluffy_Pillow 43092.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
3:41.982 combustion_phase Z pyroblast Fluffy_Pillow 43754.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:43.144 combustion_phase b phoenix_flames Fluffy_Pillow 43916.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
3:44.304 combustion_phase Z pyroblast Fluffy_Pillow 45076.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:44.304 combustion_phase U fire_blast Fluffy_Pillow 44076.0/50000: 88% mana combustion, rune_of_power, gladiators_badge
3:45.468 combustion_phase Z pyroblast Fluffy_Pillow 44740.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:46.630 combustion_phase b phoenix_flames Fluffy_Pillow 44902.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:47.792 default O rune_of_power Fluffy_Pillow 46064.0/50000: 92% mana hot_streak, gladiators_badge
3:48.953 rop_phase g pyroblast Fluffy_Pillow 47225.0/50000: 94% mana hot_streak, rune_of_power, gladiators_badge
3:50.115 rop_phase m scorch Fluffy_Pillow 47387.0/50000: 95% mana rune_of_power, gladiators_badge
3:51.171 rop_phase h fire_blast Fluffy_Pillow 48387.0/50000: 97% mana rune_of_power
3:51.277 rop_phase k pyroblast Fluffy_Pillow 47549.0/50000: 95% mana heating_up, rune_of_power
3:52.451 rop_phase m scorch Fluffy_Pillow 47723.0/50000: 95% mana rune_of_power
3:53.614 rop_phase m scorch Fluffy_Pillow 48386.0/50000: 97% mana rune_of_power
3:54.776 rop_phase k pyroblast Fluffy_Pillow 49048.0/50000: 98% mana heating_up, rune_of_power
3:55.951 rop_phase m scorch Fluffy_Pillow 49223.0/50000: 98% mana rune_of_power
3:57.114 default N use_item_dreadfire_vessel Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power
3:57.114 rop_phase m scorch Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power
3:58.275 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
3:58.892 rop_phase h fire_blast Fluffy_Pillow 49115.0/50000: 98% mana rune_of_power, firestorm
3:59.448 rop_phase f pyroblast Fluffy_Pillow 49176.0/50000: 98% mana hot_streak, rune_of_power, firestorm
4:00.611 default M mirror_image Fluffy_Pillow 49339.0/50000: 99% mana heating_up, rune_of_power, firestorm
4:01.773 standard_rotation o pyroblast Fluffy_Pillow 49501.0/50000: 99% mana heating_up, firestorm
4:02.936 standard_rotation q pyroblast Fluffy_Pillow 49664.0/50000: 99% mana hot_streak
4:04.098 standard_rotation t phoenix_flames Fluffy_Pillow 49826.0/50000: 100% mana heating_up
4:05.260 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana entropic_embrace
4:06.423 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana entropic_embrace
4:07.584 standard_rotation r fire_blast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, entropic_embrace
4:07.584 standard_rotation q pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak, entropic_embrace
4:08.746 standard_rotation v scorch Fluffy_Pillow 49165.0/50000: 98% mana entropic_embrace
4:09.908 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana entropic_embrace
4:11.070 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, entropic_embrace
4:12.244 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana entropic_embrace
4:13.405 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana entropic_embrace
4:14.569 standard_rotation r fire_blast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, entropic_embrace
4:14.569 standard_rotation q pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak, entropic_embrace
4:15.732 standard_rotation v scorch Fluffy_Pillow 49169.0/50000: 98% mana hot_streak, entropic_embrace
4:16.894 standard_rotation q pyroblast Fluffy_Pillow 49504.0/50000: 99% mana hot_streak
4:18.057 standard_rotation v scorch Fluffy_Pillow 49667.0/50000: 99% mana
4:19.218 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:20.381 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:21.553 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:22.055 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
4:22.716 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:23.890 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:25.053 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:26.214 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:27.389 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:28.554 standard_rotation v scorch Fluffy_Pillow 49507.0/50000: 99% mana
4:29.717 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:29.776 standard_rotation q pyroblast Fluffy_Pillow 49064.0/50000: 98% mana hot_streak
4:30.938 standard_rotation v scorch Fluffy_Pillow 49226.0/50000: 98% mana
4:32.102 standard_rotation v scorch Fluffy_Pillow 49506.0/50000: 99% mana
4:33.265 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:34.438 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:35.601 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:36.762 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:37.936 default O rune_of_power Fluffy_Pillow 49677.0/50000: 99% mana
4:39.100 rop_phase h fire_blast Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
4:39.100 rop_phase m scorch Fluffy_Pillow 49500.0/50000: 99% mana heating_up, rune_of_power
4:40.263 rop_phase k pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, rune_of_power
4:41.438 rop_phase m scorch Fluffy_Pillow 49680.0/50000: 99% mana rune_of_power
4:42.601 rop_phase m scorch Fluffy_Pillow 49505.0/50000: 99% mana rune_of_power
4:43.763 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
4:44.936 rop_phase f pyroblast Fluffy_Pillow 49677.0/50000: 99% mana heating_up, rune_of_power, firestorm
4:45.218 rop_phase i fire_blast Fluffy_Pillow 48877.0/50000: 98% mana heating_up, rune_of_power, firestorm
4:46.098 rop_phase f pyroblast Fluffy_Pillow 49339.0/50000: 99% mana hot_streak, rune_of_power, firestorm
4:47.262 rop_phase f pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power, firestorm
4:48.425 combustion_phase Y pyroblast Fluffy_Pillow 49666.0/50000: 99% mana hot_streak, rune_of_power, firestorm
4:49.588 combustion_phase c fireball Fluffy_Pillow 49829.0/50000: 100% mana heating_up, rune_of_power
4:50.888 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power
4:51.330 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44442.0/50000: 89% mana combustion, heating_up, rune_of_power
4:51.330 combustion_phase b phoenix_flames Fluffy_Pillow 44442.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
4:52.494 combustion_phase Z pyroblast Fluffy_Pillow 45606.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:52.994 combustion_phase U fire_blast Fluffy_Pillow 45106.0/50000: 90% mana combustion, rune_of_power, gladiators_badge
4:53.657 combustion_phase Z pyroblast Fluffy_Pillow 45269.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:54.819 combustion_phase b phoenix_flames Fluffy_Pillow 45431.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.980 combustion_phase Z pyroblast Fluffy_Pillow 46592.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:57.143 combustion_phase d scorch Fluffy_Pillow 46755.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
4:58.305 combustion_phase a pyroblast Fluffy_Pillow 47417.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
4:59.476 combustion_phase d scorch Fluffy_Pillow 47588.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
5:00.637 combustion_cooldowns S potion Fluffy_Pillow 48249.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge
5:00.637 combustion_phase a pyroblast Fluffy_Pillow 48249.0/50000: 96% mana combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
5:00.749 combustion_phase U fire_blast Fluffy_Pillow 47361.0/50000: 95% mana combustion, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
5:01.811 combustion_phase Y pyroblast Fluffy_Pillow 47923.0/50000: 96% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge, potion_of_spectral_intellect
5:02.974 standard_rotation o pyroblast Fluffy_Pillow 48086.0/50000: 96% mana heating_up, firestorm, gladiators_badge, potion_of_spectral_intellect
5:04.137 standard_rotation o pyroblast Fluffy_Pillow 48249.0/50000: 96% mana hot_streak, firestorm, gladiators_badge, potion_of_spectral_intellect
5:05.300 standard_rotation t phoenix_flames Fluffy_Pillow 48412.0/50000: 97% mana heating_up, entropic_embrace, gladiators_badge, potion_of_spectral_intellect
5:06.464 standard_rotation v scorch Fluffy_Pillow 49576.0/50000: 99% mana entropic_embrace, potion_of_spectral_intellect
5:07.627 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana entropic_embrace, potion_of_spectral_intellect
5:08.791 standard_rotation r fire_blast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, entropic_embrace, potion_of_spectral_intellect
5:08.791 standard_rotation q pyroblast Fluffy_Pillow 49006.0/50000: 98% mana hot_streak, entropic_embrace, potion_of_spectral_intellect
5:09.954 standard_rotation v scorch Fluffy_Pillow 49169.0/50000: 98% mana entropic_embrace, potion_of_spectral_intellect
5:11.116 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana entropic_embrace, potion_of_spectral_intellect
5:12.279 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, entropic_embrace, potion_of_spectral_intellect
5:13.452 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana entropic_embrace, potion_of_spectral_intellect
5:14.615 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana entropic_embrace, potion_of_spectral_intellect
5:15.778 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up, entropic_embrace, potion_of_spectral_intellect
5:16.949 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana potion_of_spectral_intellect
5:16.949 standard_rotation r fire_blast Fluffy_Pillow 49676.0/50000: 99% mana potion_of_spectral_intellect
5:18.114 standard_rotation s pyroblast Fluffy_Pillow 49507.0/50000: 99% mana heating_up, potion_of_spectral_intellect
5:19.285 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana potion_of_spectral_intellect

Stats

Level Bonus (60) Race Bonus (void_elf) Raid-Buffed Unbuffed Gear Amount
Strength 198 -3 195 195 0
Agility 306 1 307 307 0
Stamina 414 0 2018 1922 1508
Intellect 450 2 1819 1638 1108 (132)
Spirit 0 0 0 0 0
Health 40360 38440 0
Mana 50000 50000 0
Spell Power 1819 1638 0
Melee Crit 9.46% 9.46% 156
Spell Crit 24.46% 24.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="void_elf"
source=default
spec=fire
level=60
race=void_elf
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

worgen : 5067 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
5067.0 5067.0 9.4 / 0.185% 773.9 / 15.3% 6.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
799.4 794.6 Mana 0.00% 57.2 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worgen 5067
Conflagration Flare Up 24 0.5% 29.9 9.65sec 237 0 Direct 29.9 150 374 237 39.1%

Stats Details: Conflagration Flare Up

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.91 29.91 0.00 0.00 0.0000 0.0000 7098.19 7098.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.86% 18.20 5 34 149.60 130 254 149.66 131 180 2723 2723 0.00%
crit 39.14% 11.71 3 28 373.78 259 509 373.97 259 480 4375 4375 0.00%

Action Details: Conflagration Flare Up

  • id:205345
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.067500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205345
  • name:Conflagration Flare Up
  • school:fire
  • tooltip:
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Dragon's Breath 11 0.2% 0.8 94.04sec 3889 3349 Direct 0.8 0 3889 3889 100.0%

Stats Details: Dragons Breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.82 0.82 0.00 0.00 1.1625 0.0000 3198.19 3198.19 0.00% 3348.89 3348.89
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.82 0 4 3889.15 3781 4392 2373.41 0 4392 3198 3198 0.00%

Action Details: Dragons Breath

  • id:31661
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:18.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.582500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:31661
  • name:Dragon's Breath
  • school:fire
  • tooltip:Disoriented.
  • description:Enemies in a cone in front of you take {$s2=0} Fire damage and are disoriented for {$d=4 seconds}. Damage will cancel the effect.

Action Priority List

    combustion_phase
    [e]:0.82
  • if_expr:buff.combustion.remains<gcd.max&buff.combustion.up
Dreadfire Vessel 161 3.2% 3.3 103.33sec 14647 0 Direct 3.3 11646 23324 14696 26.1%

Stats Details: Dreadfire Vessel

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.30 3.29 0.00 0.00 0.0000 0.0000 48300.36 48300.36 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.95% 2.43 0 4 11646.45 11342 12023 11429.53 0 12023 28318 28318 0.00%
crit 26.05% 0.86 0 4 23324.47 22685 24046 14427.09 0 24046 19982 19982 0.00%

Action Details: Dreadfire Vessel

  • id:344732
  • school:fire
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10071.64
  • base_dd_max:10071.64
  • base_dd_mult:1.00

Spelldata

  • id:344732
  • name:Dreadfire Vessel
  • school:fire
  • tooltip:
  • description:Unleash incendiary flames at your target inflicting {$s1=0} Fire damage.
Fire Blast 600 11.8% 42.3 7.14sec 4250 0 Direct 42.3 0 4250 4250 100.0%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.33 42.33 0.00 0.00 0.0000 0.0000 179868.33 179868.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 42.33 32 50 4249.77 3040 5972 4251.36 4053 4547 179868 179868 0.00%

Action Details: Fire Blast

  • id:108853
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:10.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:1.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.792000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. |cFFFFFFFFFire:|r Castable while casting other spells.$?a231568[ Always deals a critical strike.][]

Action Priority List

    combustion_phase
    [U]:16.79
  • if_expr:!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
    rop_phase
    [h]:2.92
  • if_expr:buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
    rop_phase
    [i]:5.33
  • if_expr:!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
    standard_rotation
    [r]:17.28
  • if_expr:!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Fireball 611 (640) 12.1% (12.6%) 77.0 3.40sec 2492 1499 Direct 77.0 (220.3) 1653 3438 2383 40.9% (40.9%)

Stats Details: Fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.02 77.01 0.00 0.00 1.6628 0.0000 183501.24 183501.24 0.00% 1498.95 1498.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.09% 45.50 25 64 1652.51 1435 2572 1653.05 1505 1779 75198 75198 0.00%
crit 40.91% 31.50 20 48 3437.90 2869 5636 3440.55 3221 3705 108303 108303 0.00%

Action Details: Fireball

  • id:133
  • school:fire
  • range:40.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=0} Fire damage.$?a157642[ Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.][]

Action Priority List

    combustion_phase
    [c]:4.70
  • if_expr:buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
    rop_phase
    [n]:20.68
    standard_rotation
    [w]:51.67
    Conflagration 28 0.6% 77.0 3.39sec 110 0 Periodic 143.3 35 90 59 43.5% 69.0%

Stats Details: Conflagration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 77.01 0.00 143.33 143.33 0.0000 1.4469 8454.54 8454.54 0.00% 40.77 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 56.49% 80.96 54 111 35.44 0 57 35.43 33 38 2869 2869 0.00%
crit 43.51% 62.37 44 87 89.56 0 124 89.65 83 97 5585 5585 0.00%

Action Details: Conflagration

  • id:226757
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.016500
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=0} Fire damage to nearby enemies.}
Ignite 959 18.9% 264.9 1.13sec 1086 0 Periodic 299.2 962 0 962 0.0% 99.6%

Stats Details: Ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 264.88 0.00 299.20 299.20 0.0000 1.0000 287763.10 287763.10 0.00% 961.78 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 299.20 239 359 961.76 151 2909 962.88 839 1172 287763 287763 0.00%

Action Details: Ignite

  • id:12654
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.$?$w3>0[ Movement speed reduced by $w3%.][]
  • description:{$@spelldesc12846=Your target burns for an additional ${{$s1=0}}.1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s257541=true}[, Phoenix Flames][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Phoenix Flames causes your Ignites to spread to {$s4=8} nearby enemies.}
Mirror Image 0 (37) 0.0% (0.7%) 3.0 120.42sec 3688 4769

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.7735 0.0000 0.00 0.00 0.00% 4769.36 4769.36

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.

Action Priority List

    default
    [M]:1.99
  • if_expr:buff.combustion.down&debuff.radiant_spark_vulnerability.down
    Frostbolt (mirror_image) 98  / 37 0.7% 236.0 3.45sec 47 33 Direct 235.3 37 75 47 25.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 235.99 235.26 0.00 0.00 1.3988 0.0000 11022.00 11022.00 0.00% 33.39 33.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.45% 175.16 120 206 37.29 28 53 37.37 35 41 6532 6532 0.00%
crit 25.55% 60.10 28 87 74.70 57 106 74.87 66 87 4490 4490 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:81.69
Phoenix Flames 0 (242) 0.0% (4.8%) 14.1 21.72sec 5124 4652

Stats Details: Phoenix Flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.13 0.00 0.00 0.00 1.1015 0.0000 0.00 0.00 0.00% 4652.02 4652.02

Action Details: Phoenix Flames

  • id:257541
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:25.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:257541
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.

Action Priority List

    combustion_phase
    [b]:10.08
  • if_expr:buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
    rop_phase
    [l]:1.35
  • if_expr:!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    standard_rotation
    [t]:2.70
  • if_expr:!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
    Phoenix Flames (_splash) 242 4.8% 14.1 21.72sec 5139 0 Direct 14.1 2092 5968 5142 78.6%

Stats Details: Phoenix Flames Splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 0.00 0.00 0.0000 0.0000 72413.31 72413.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 21.37% 3.01 0 8 2092.44 1727 3393 2054.56 0 3393 6298 6298 0.00%
crit 78.63% 11.08 6 16 5968.47 3454 6786 5974.76 5256 6413 66115 66115 0.00%

Action Details: Phoenix Flames Splash

  • id:257542
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.900000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:257542
  • name:Phoenix Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc257541=Hurls a Phoenix that deals {$257542s2=0} Fire damage to the target and reduced damage to other nearby enemies.}
Pyroblast 2053 (2185) 40.5% (43.1%) 97.2 3.09sec 6746 6039 Direct 97.9 (276.1) 3080 7723 6297 69.3% (69.3%)

Stats Details: Pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.18 97.86 0.00 0.00 1.1172 0.0000 616186.06 616186.06 0.00% 6038.75 6038.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 30.73% 30.07 15 45 3079.73 2616 5139 3079.49 2762 3400 92598 92598 0.00%
crit 69.27% 67.79 40 108 7723.45 5232 10277 7746.95 7022 8649 523588 523588 0.00%

Action Details: Pyroblast

  • id:11366
  • school:fire
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.363000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=0} Fire damage$?a321711[ and an additional $321712o2 Fire damage over {$321712d=6 seconds}][].

Action Priority List

    combustion_phase
    [Y]:7.22
  • if_expr:buff.firestorm.react
    combustion_phase
    [Z]:25.61
  • if_expr:buff.hot_streak.react&buff.combustion.up
    combustion_phase
    [a]:3.17
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
    rop_phase
    [f]:4.78
  • if_expr:buff.firestorm.react
    rop_phase
    [g]:9.46
  • if_expr:buff.hot_streak.react
    rop_phase
    [k]:3.49
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    standard_rotation
    [o]:12.80
  • if_expr:buff.firestorm.react
    standard_rotation
    [p]:15.59
  • if_expr:buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
    standard_rotation
    [q]:4.30
  • if_expr:buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [s]:10.76
  • if_expr:prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
    Pyroblast (_dot) 131 2.6% 97.9 3.09sec 403 0 Periodic 178.3 136 347 221 40.4% 86.8%

Stats Details: Pyroblast Dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 97.86 0.00 178.25 178.25 0.0000 1.4628 39392.53 39392.53 0.00% 151.08 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 59.59% 106.22 68 142 135.87 5 234 135.86 128 144 14431 14431 0.00%
crit 40.41% 72.04 48 105 346.50 10 467 347.06 323 377 24961 24961 0.00%

Action Details: Pyroblast Dot

  • id:321712
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.062000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:321712
  • name:Pyroblast
  • school:fire
  • tooltip:Suffering $w1 Fire damage every {$t2=0} sec.
  • description:{$@spelldesc321711=Deals an additional $321712o2 Fire damage over {$321712d=6 seconds}.}
Scorch 211 4.2% 33.6 6.88sec 1888 1637 Direct 33.6 0 1889 1889 100.0%

Stats Details: Scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.63 33.63 0.00 0.00 1.1536 0.0000 63508.34 63508.34 0.00% 1637.07 1637.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 33.63 16 52 1888.88 951 3337 1889.82 1670 2202 63508 63508 0.00%

Action Details: Scorch

  • id:2948
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.177000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=0} Fire damage. Castable while moving.

Action Priority List

    combustion_phase
    [d]:3.64
  • if_expr:buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
    rop_phase
    [m]:8.16
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
    standard_rotation
    [v]:22.19
  • if_expr:target.health.pct<=30&talent.searing_touch.enabled
Simple Action Stats Execute Interval
worgen
Combustion 4.7 70.69sec

Stats Details: Combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.68 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Combustion

  • id:190319
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.

Action Priority List

    combustion_phase
    [W]:4.68
  • if_expr:buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worgen
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worgen
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Spectral Intellect (potion) 1.2 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307162
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    combustion_cooldowns
    [S]:1.17
Rune of Power 5.3 60.25sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 0.00 0.00 0.00 1.1119 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    default
    [O]:5.32
  • if_expr:buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.7 0.0 70.5sec 70.5sec 11.8sec 18.46% 0.00% 106.1 (106.1) 4.6

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_combustion
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:49.7s / 86.9s
  • trigger_min/max:49.7s / 86.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • combustion_1:18.46%

Spelldata

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance of your spells increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your spells' critical strike chance by {$s1=100}% and granting you Mastery equal to {$s3=50}% your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Fireball 21.6 23.9 9.1sec 4.3sec 5.0sec 36.18% 0.00% 0.0 (0.0) 0.4

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_fireball
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.7s / 54.3s
  • trigger_min/max:1.3s / 48.5s
  • trigger_pct:100.00%
  • duration_min/max:1.3s / 30.1s

Stack Uptimes

  • fireball_1:20.50%
  • fireball_2:8.89%
  • fireball_3:4.26%
  • fireball_4:1.77%
  • fireball_5:0.60%
  • fireball_6:0.15%
  • fireball_7:0.03%
  • fireball_8:0.01%

Spelldata

  • id:157644
  • name:Fireball
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%$?a337224[ and your Mastery by ${{$s2=0}}.1%][].
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Firestorm 7.8 0.8 36.6sec 32.6sec 4.2sec 10.96% 0.00% 0.8 (0.8) 7.6

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_firestorm
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:1.66
  • modifier:1.00

Trigger Details

  • interval_min/max:4.0s / 168.7s
  • trigger_min/max:0.8s / 168.7s
  • trigger_pct:10.10%
  • duration_min/max:0.0s / 14.4s

Stack Uptimes

  • firestorm_1:10.96%

Spelldata

  • id:333100
  • name:Firestorm
  • tooltip:Pyroblast and Flamestrike have no cast time and are guaranteed to critically strike.
  • description:{$@spelldesc333097=When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:333097
  • name:Firestorm
  • tooltip:
  • description:When Hot Streak activates, you have a low chance to cause all Pyroblasts and Flamestrikes to have no cast time and be guaranteed critical strikes for {$333100d=4 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Gladiator's Badge 4.7 0.0 70.9sec 72.6sec 14.7sec 22.98% 0.00% 0.0 (0.0) 4.5

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:342.00

Trigger Details

  • interval_min/max:60.0s / 86.9s
  • trigger_min/max:60.0s / 86.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:22.98%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=252} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Heating Up 96.8 0.0 3.1sec 3.1sec 1.1sec 35.49% 46.73% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_heating_up
  • max_stacks:2
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 19.1s
  • trigger_min/max:0.2s / 19.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.2s

Stack Uptimes

  • heating_up_1:35.49%

Spelldata

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 84.9 0.0 3.5sec 3.5sec 0.6sec 13.25% 86.54% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.6s / 28.7s
  • trigger_min/max:0.6s / 28.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.8s

Stack Uptimes

  • hot_streak_1:13.25%

Spelldata

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row with Fire spells will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Spectral Intellect 1.2 0.0 309.8sec 0.0sec 23.8sec 9.30% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_potion_of_spectral_intellect
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:190.00

Trigger Details

  • interval_min/max:300.0s / 359.1s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_spectral_intellect_1:9.30%

Spelldata

  • id:307162
  • name:Potion of Spectral Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=190} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Rune of Power 9.8 0.2 31.8sec 31.1sec 11.9sec 38.94% 0.00% 0.2 (0.2) 9.4

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 73.7s
  • trigger_min/max:4.8s / 73.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 24.0s

Stack Uptimes

  • rune_of_power_1:38.94%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Heating Up generated 96.8 72.0 125.0 3.1s 0.2s 19.1s
Heating Up removed 11.5 2.0 23.0 23.6s 0.9s 253.8s
Heating Up converted with Fire Blast 23.5 13.0 36.0 12.1s 0.6s 120.6s
Hot Streak procs 84.9 61.0 115.0 3.5s 0.6s 28.7s
Hot Streak spells used 264.9 212.0 320.0 1.1s 0.0s 5.3s
Hot Streak spell crits 186.3 140.0 242.0 1.6s 0.0s 18.8s
Hot Streak spell crits wasted 4.6 0.0 12.0 64.2s 0.0s 352.6s
Direct Ignite applications 1.0 1.0 1.0 0.0s 0.0s 0.0s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 13.93% 8.30% 18.85% 0.5s 0.0s 4.3s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.3180.00012.8810.9490.00013.158
Rune of Power14.0830.00040.77376.74317.877129.324
Fire Blast0.0940.00025.9943.9671.30032.778
Dragon's Breath140.00342.431355.490285.993195.509359.850
Combustion2.2341.30013.34010.5225.66126.448
Phoenix Flames0.2090.00027.6582.9731.73839.196

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
worgen
mana_regen Mana 2166.94 238772.02 100.00% 110.19 61381.96 20.45%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 49000.0 794.61 799.41 61394.1 48557.6 42265.0 50000.0
Usage Type Count Total Avg RPE APR
worgen
combustion Mana 4.7 23416.0 5000.0 5002.5 0.0
dragons_breath Mana 0.8 1646.9 2000.0 2002.6 1.9
fire_blast Mana 42.3 21163.0 500.0 500.0 8.5
fireball Mana 77.0 77026.0 1000.0 1000.1 2.5
mirror_image Mana 3.0 1988.5 665.4 665.4 5.5
pyroblast Mana 98.2 98177.1 1000.0 1010.3 6.7
scorch Mana 33.6 16805.0 500.0 499.7 3.8

Statistics & Data Analysis

Fight Length
worgen Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
worgen Damage Per Second
Count 1717
Mean 5067.03
Minimum 4535.13
Maximum 6048.43
Spread ( max - min ) 1513.30
Range [ ( max - min ) / 2 * 100% ] 14.93%
Standard Deviation 198.2861
5th Percentile 4759.49
95th Percentile 5421.04
( 95th Percentile - 5th Percentile ) 661.55
Mean Distribution
Standard Deviation 4.7853
95.00% Confidence Interval ( 5057.65 - 5076.40 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5883
0.1 Scale Factor Error with Delta=300 336
0.05 Scale Factor Error with Delta=300 1343
0.01 Scale Factor Error with Delta=300 33564
Priority Target DPS
worgen Priority Target Damage Per Second
Count 1717
Mean 5067.03
Minimum 4535.13
Maximum 6048.43
Spread ( max - min ) 1513.30
Range [ ( max - min ) / 2 * 100% ] 14.93%
Standard Deviation 198.2861
5th Percentile 4759.49
95th Percentile 5421.04
( 95th Percentile - 5th Percentile ) 661.55
Mean Distribution
Standard Deviation 4.7853
95.00% Confidence Interval ( 5057.65 - 5076.40 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5883
0.1 Scale Factor Error with Delta=300 336
0.05 Scale Factor Error with Delta=300 1343
0.01 Scale Factor Error with Delta=300 33564
DPS(e)
worgen Damage Per Second (Effective)
Count 1717
Mean 5067.03
Minimum 4535.13
Maximum 6048.43
Spread ( max - min ) 1513.30
Range [ ( max - min ) / 2 * 100% ] 14.93%
Damage
worgen Damage
Count 1717
Mean 1509684.19
Minimum 1136159.71
Maximum 1988953.20
Spread ( max - min ) 852793.48
Range [ ( max - min ) / 2 * 100% ] 28.24%
DTPS
worgen Damage Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
worgen Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
worgen Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
worgen Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
worgen Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
worgen Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
worgenTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
worgen Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 arcane_intellect
4 0.00 variable,name=disable_combustion,op=reset
If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
5 0.00 variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
6 0.00 variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
7 0.00 variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
8 0.00 variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
9 0.00 variable,name=arcane_explosion_mana,default=40,op=reset
This variable specifies the percentage of mana below which Arcane Explosion will not be used.
A 0.00 variable,name=kindling_reduction,default=0.2,op=reset
With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
B 0.00 variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
C 0.00 variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
The duration of a Sun King's Blessing Combustion.
D 0.00 variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
E 0.00 variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
F 0.00 variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
G 0.00 variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
H 0.00 variable,name=empyreal_ordnance_delay,default=18,op=reset
How long before Combustion should Empyreal Ordnance be used?
I 0.00 snapshot_stats
J 0.00 use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
K 0.00 mirror_image
L 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=!runeforge.disciplinary_command.equipped
0.00 variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
0.00 variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
0.00 shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
0.00 radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
0.00 deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
M 1.99 mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
0.00 use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
0.00 use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
0.00 use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
N 3.29 use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
0.00 use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
0.00 guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
0.00 concentrated_flame
0.00 reaping_flames
0.00 focused_azerite_beam
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force
0.00 counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
Get the disciplinary_command buff up, unless combustion is soon.
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
O 5.32 rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
P 0.00 call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
0.00 variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
0.00 variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
Q 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
R 0.00 call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down
actions.combustion_cooldowns
# count action,conditions
S 1.17 potion
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
0.00 use_items
T 4.67 use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.combustion_phase
# count action,conditions
0.00 lights_judgment,if=buff.combustion.down
0.00 variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
0.00 variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
0.00 bag_of_tricks,if=buff.combustion.down
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
0.00 mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
0.00 use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
0.00 blood_of_the_enemy
0.00 memory_of_lucid_dreams
0.00 worldvein_resonance
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
0.00 fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
U 16.79 fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
0.00 counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
V 0.00 call_action_list,name=active_talents
W 4.68 combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
X 0.00 call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
0.00 flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
Y 7.22 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
Z 25.61 pyroblast,if=buff.hot_streak.react&buff.combustion.up
a 3.17 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
b 10.08 phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
c 4.70 fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
d 3.64 scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
0.00 living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
e 0.82 dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
0.00 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
f 4.78 pyroblast,if=buff.firestorm.react
g 9.46 pyroblast,if=buff.hot_streak.react
h 2.92 fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
i 5.33 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
j 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
k 3.49 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
l 1.35 phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
m 8.16 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 dragons_breath,if=active_enemies>2
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
n 20.68 fireball
actions.standard_rotation
# count action,conditions
0.00 flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
o 12.80 pyroblast,if=buff.firestorm.react
0.00 pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
p 15.59 pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
0.00 pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
Try to get SKB procs inside RoP phases or Combustion phases when possible.
q 4.30 pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
0.00 pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
r 17.28 fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
s 10.76 pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
t 2.70 phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
u 0.00 call_action_list,name=active_talents
0.00 dragons_breath,if=active_enemies>1
v 22.19 scorch,if=target.health.pct<=30&talent.searing_touch.enabled
0.00 arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
0.00 flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
w 51.67 fireball
0.00 scorch

Sample Sequence

01456789ACDEFHKLSTcWUbZUZUZbZbZUZdadaUOgnnnnNgnignnipwwwwwwrpwwwwrpwrpwwwwwrpooooocWTZZUZbZUZbZdaUOgnnlnnnnrpwrpwwwrpwwwwrpwwNwwwwrpwMOgnnnhgnnncWUTbZUYYZbZUZdawwtwwrpwwwwwwrOgnnnhgnignwpwwwwrpwrpwwwwwwwwcWTZZUZUZUZbZbZUZOmkmkhlmmNkfffiooqMvsvrqvvsvvrqvvsvvrqvvsvvsvrqvvsvvsvvsooYcWTZZUZUZbZUZbZYOghmgmmkmhkfffooqtvrsvv

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask worgen 50000.0/50000: 100% mana
Pre precombat 1 food worgen 50000.0/50000: 100% mana
Pre precombat 4 disable_combustion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 5 hot_streak_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 6 hard_cast_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 7 combustion_flamestrike Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 8 arcane_explosion Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat 9 arcane_explosion_mana Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat A kindling_reduction Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat C skb_duration Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat D combustion_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat E font_double_on_use Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat F on_use_cutoff Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat H empyreal_ordnance_delay Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat K mirror_image Fluffy_Pillow 50000.0/50000: 100% mana
Pre precombat L pyroblast Fluffy_Pillow 50000.0/50000: 100% mana
0:00.000 combustion_cooldowns S potion Fluffy_Pillow 49000.0/50000: 98% mana
0:00.000 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 49000.0/50000: 98% mana potion_of_spectral_intellect
0:00.000 combustion_phase c fireball Fluffy_Pillow 49000.0/50000: 98% mana gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, gladiators_badge, potion_of_spectral_intellect
0:01.300 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:01.741 combustion_phase b phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.634 combustion_phase Z pyroblast Fluffy_Pillow 44834.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:02.634 combustion_phase U fire_blast Fluffy_Pillow 43834.0/50000: 88% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.529 combustion_phase Z pyroblast Fluffy_Pillow 44229.0/50000: 88% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:03.529 combustion_phase U fire_blast Fluffy_Pillow 43229.0/50000: 86% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:04.423 combustion_phase Z pyroblast Fluffy_Pillow 43623.0/50000: 87% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:05.318 combustion_phase b phoenix_flames Fluffy_Pillow 43518.0/50000: 87% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:06.212 combustion_phase Z pyroblast Fluffy_Pillow 44412.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:07.106 combustion_phase b phoenix_flames Fluffy_Pillow 44306.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.001 combustion_phase Z pyroblast Fluffy_Pillow 45201.0/50000: 90% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.001 combustion_phase U fire_blast Fluffy_Pillow 44201.0/50000: 88% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:08.896 combustion_phase Z pyroblast Fluffy_Pillow 44596.0/50000: 89% mana bloodlust, combustion, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:09.790 combustion_phase d scorch Fluffy_Pillow 44490.0/50000: 89% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:10.685 combustion_phase a pyroblast Fluffy_Pillow 44885.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:11.590 combustion_phase d scorch Fluffy_Pillow 44790.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:12.485 combustion_phase a pyroblast Fluffy_Pillow 45185.0/50000: 90% mana bloodlust, combustion, heating_up, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.195 combustion_phase U fire_blast Fluffy_Pillow 44895.0/50000: 90% mana bloodlust, combustion, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:13.389 default O rune_of_power Fluffy_Pillow 44589.0/50000: 89% mana bloodlust, hot_streak, gladiators_badge, potion_of_spectral_intellect
0:14.285 rop_phase g pyroblast Fluffy_Pillow 45485.0/50000: 91% mana bloodlust, hot_streak, rune_of_power, gladiators_badge, potion_of_spectral_intellect
0:15.181 rop_phase n fireball Fluffy_Pillow 45381.0/50000: 91% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:16.522 rop_phase n fireball Fluffy_Pillow 45722.0/50000: 91% mana bloodlust, rune_of_power, potion_of_spectral_intellect
0:17.862 rop_phase n fireball Fluffy_Pillow 46062.0/50000: 92% mana bloodlust, heating_up, rune_of_power, potion_of_spectral_intellect
0:19.201 rop_phase n fireball Fluffy_Pillow 46401.0/50000: 93% mana bloodlust, hot_streak, rune_of_power, potion_of_spectral_intellect
0:20.542 default N use_item_dreadfire_vessel Fluffy_Pillow 46742.0/50000: 93% mana bloodlust, fireball, hot_streak, rune_of_power, potion_of_spectral_intellect
0:20.542 rop_phase g pyroblast Fluffy_Pillow 46742.0/50000: 93% mana bloodlust, fireball, hot_streak, rune_of_power, potion_of_spectral_intellect
0:21.436 rop_phase n fireball Fluffy_Pillow 46636.0/50000: 93% mana bloodlust, fireball(2), heating_up, rune_of_power, potion_of_spectral_intellect
0:22.336 rop_phase i fire_blast Fluffy_Pillow 47536.0/50000: 95% mana bloodlust, fireball(2), heating_up, rune_of_power, potion_of_spectral_intellect
0:22.778 rop_phase g pyroblast Fluffy_Pillow 46478.0/50000: 93% mana bloodlust, fireball(2), hot_streak, rune_of_power, potion_of_spectral_intellect
0:23.673 rop_phase n fireball Fluffy_Pillow 46373.0/50000: 93% mana bloodlust, fireball(3), rune_of_power, potion_of_spectral_intellect
0:25.015 rop_phase n fireball Fluffy_Pillow 46715.0/50000: 93% mana bloodlust, fireball(3), rune_of_power
0:26.115 rop_phase i fire_blast Fluffy_Pillow 47815.0/50000: 96% mana bloodlust, heating_up, rune_of_power
0:26.355 standard_rotation p pyroblast Fluffy_Pillow 46555.0/50000: 93% mana bloodlust, hot_streak
0:27.250 standard_rotation w fireball Fluffy_Pillow 46450.0/50000: 93% mana bloodlust, heating_up
0:28.592 standard_rotation w fireball Fluffy_Pillow 46792.0/50000: 94% mana bloodlust, heating_up
0:29.933 standard_rotation w fireball Fluffy_Pillow 47133.0/50000: 94% mana bloodlust, fireball
0:31.273 standard_rotation w fireball Fluffy_Pillow 47473.0/50000: 95% mana bloodlust, fireball(2)
0:32.615 standard_rotation w fireball Fluffy_Pillow 47815.0/50000: 96% mana bloodlust, fireball(3)
0:33.954 standard_rotation w fireball Fluffy_Pillow 48154.0/50000: 96% mana bloodlust, fireball(4)
0:35.154 standard_rotation r fire_blast Fluffy_Pillow 49354.0/50000: 99% mana bloodlust, heating_up
0:35.295 standard_rotation p pyroblast Fluffy_Pillow 47995.0/50000: 96% mana bloodlust, hot_streak
0:36.190 standard_rotation w fireball Fluffy_Pillow 47890.0/50000: 96% mana bloodlust, fireball
0:37.531 standard_rotation w fireball Fluffy_Pillow 48231.0/50000: 96% mana bloodlust, fireball
0:38.872 standard_rotation w fireball Fluffy_Pillow 48572.0/50000: 97% mana bloodlust, fireball(2)
0:40.214 standard_rotation w fireball Fluffy_Pillow 48914.0/50000: 98% mana bloodlust, fireball(3)
0:41.514 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:41.554 standard_rotation p pyroblast Fluffy_Pillow 48540.0/50000: 97% mana hot_streak
0:42.715 standard_rotation w fireball Fluffy_Pillow 48701.0/50000: 97% mana fireball, heating_up
0:44.015 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
0:44.456 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana fireball, hot_streak
0:45.620 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana fireball(2), heating_up
0:47.361 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2), heating_up
0:49.103 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(3)
0:50.846 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana heating_up
0:52.587 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
0:53.987 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
0:54.329 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak, firestorm
0:55.491 standard_rotation o pyroblast Fluffy_Pillow 49004.0/50000: 98% mana fireball, heating_up, firestorm
0:56.654 standard_rotation o pyroblast Fluffy_Pillow 49167.0/50000: 98% mana fireball, hot_streak, firestorm
0:57.816 standard_rotation o pyroblast Fluffy_Pillow 49329.0/50000: 99% mana fireball, heating_up, firestorm
0:58.980 standard_rotation o pyroblast Fluffy_Pillow 49493.0/50000: 99% mana fireball, hot_streak, firestorm
1:00.142 standard_rotation o pyroblast Fluffy_Pillow 49655.0/50000: 99% mana fireball, heating_up, firestorm
1:01.304 combustion_phase c fireball Fluffy_Pillow 49817.0/50000: 100% mana fireball, hot_streak
1:02.604 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
1:03.047 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44443.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power
1:03.047 combustion_phase Z pyroblast Fluffy_Pillow 44443.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, gladiators_badge
1:04.211 combustion_phase Z pyroblast Fluffy_Pillow 44607.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:04.211 combustion_phase U fire_blast Fluffy_Pillow 43607.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
1:05.372 combustion_phase Z pyroblast Fluffy_Pillow 44268.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:06.536 combustion_phase b phoenix_flames Fluffy_Pillow 44432.0/50000: 89% mana combustion, heating_up, rune_of_power, gladiators_badge
1:07.699 combustion_phase Z pyroblast Fluffy_Pillow 45595.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:07.699 combustion_phase U fire_blast Fluffy_Pillow 44595.0/50000: 89% mana combustion, rune_of_power, gladiators_badge
1:08.861 combustion_phase Z pyroblast Fluffy_Pillow 45257.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:10.023 combustion_phase b phoenix_flames Fluffy_Pillow 45419.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
1:11.183 combustion_phase Z pyroblast Fluffy_Pillow 46579.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
1:12.346 combustion_phase d scorch Fluffy_Pillow 46742.0/50000: 93% mana combustion, heating_up, rune_of_power, gladiators_badge
1:13.508 combustion_phase a pyroblast Fluffy_Pillow 47404.0/50000: 95% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.319 combustion_phase U fire_blast Fluffy_Pillow 47215.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
1:14.681 default O rune_of_power Fluffy_Pillow 47077.0/50000: 94% mana hot_streak, gladiators_badge
1:15.844 rop_phase g pyroblast Fluffy_Pillow 48240.0/50000: 96% mana hot_streak, rune_of_power, gladiators_badge
1:17.008 rop_phase n fireball Fluffy_Pillow 48404.0/50000: 97% mana rune_of_power, gladiators_badge
1:18.750 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana rune_of_power
1:20.491 rop_phase l phoenix_flames Fluffy_Pillow 49004.0/50000: 98% mana heating_up, rune_of_power
1:21.653 rop_phase n fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball, rune_of_power
1:23.397 rop_phase n fireball Fluffy_Pillow 49007.0/50000: 98% mana fireball, rune_of_power
1:25.137 rop_phase n fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2), rune_of_power
1:26.877 rop_phase n fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(3), rune_of_power
1:28.277 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:28.619 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak
1:29.782 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
1:31.082 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:31.523 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:32.686 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
1:34.428 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:36.169 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:37.482 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:37.909 standard_rotation p pyroblast Fluffy_Pillow 48927.0/50000: 98% mana hot_streak
1:39.071 standard_rotation w fireball Fluffy_Pillow 49089.0/50000: 98% mana fireball
1:40.812 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball
1:42.553 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
1:44.295 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
1:45.595 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:46.036 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
1:47.199 standard_rotation w fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball
1:48.944 standard_rotation w fireball Fluffy_Pillow 49008.0/50000: 98% mana fireball
1:50.686 default N use_item_dreadfire_vessel Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:50.686 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
1:52.427 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
1:54.170 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball
1:55.911 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
1:57.311 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
1:57.653 standard_rotation p pyroblast Fluffy_Pillow 48842.0/50000: 98% mana hot_streak
1:58.815 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, heating_up
2:00.556 default M mirror_image Fluffy_Pillow 49004.0/50000: 98% mana fireball, heating_up
2:01.719 default O rune_of_power Fluffy_Pillow 49167.0/50000: 98% mana hot_streak
2:02.882 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, rune_of_power
2:04.043 rop_phase n fireball Fluffy_Pillow 50000.0/50000: 100% mana rune_of_power
2:05.786 rop_phase n fireball Fluffy_Pillow 49006.0/50000: 98% mana rune_of_power
2:07.528 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up, rune_of_power
2:08.428 rop_phase h fire_blast Fluffy_Pillow 49905.0/50000: 100% mana hot_streak, rune_of_power
2:09.269 rop_phase g pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, rune_of_power
2:10.431 rop_phase n fireball Fluffy_Pillow 49166.0/50000: 98% mana fireball, rune_of_power
2:12.172 rop_phase n fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball, rune_of_power
2:13.912 rop_phase n fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball(2), rune_of_power
2:15.654 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
2:16.954 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball
2:16.954 combustion_phase U fire_blast Fluffy_Pillow 45000.0/50000: 90% mana combustion, fireball, rune_of_power
2:17.395 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power
2:17.395 combustion_phase b phoenix_flames Fluffy_Pillow 43941.0/50000: 88% mana combustion, fireball, heating_up, rune_of_power, gladiators_badge
2:18.558 combustion_phase Z pyroblast Fluffy_Pillow 45104.0/50000: 90% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:18.558 combustion_phase U fire_blast Fluffy_Pillow 44104.0/50000: 88% mana combustion, rune_of_power, firestorm, gladiators_badge
2:19.721 combustion_phase Y pyroblast Fluffy_Pillow 44767.0/50000: 90% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
2:20.884 combustion_phase Y pyroblast Fluffy_Pillow 44930.0/50000: 90% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
2:22.045 combustion_phase Z pyroblast Fluffy_Pillow 45091.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:23.207 combustion_phase b phoenix_flames Fluffy_Pillow 45253.0/50000: 91% mana combustion, heating_up, rune_of_power, gladiators_badge
2:24.369 combustion_phase Z pyroblast Fluffy_Pillow 46415.0/50000: 93% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:24.369 combustion_phase U fire_blast Fluffy_Pillow 45415.0/50000: 91% mana combustion, rune_of_power, gladiators_badge
2:25.533 combustion_phase Z pyroblast Fluffy_Pillow 46079.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
2:26.697 combustion_phase d scorch Fluffy_Pillow 46243.0/50000: 92% mana combustion, heating_up, rune_of_power, gladiators_badge
2:27.858 combustion_phase a pyroblast Fluffy_Pillow 46904.0/50000: 94% mana combustion, heating_up, rune_of_power, gladiators_badge
2:29.032 standard_rotation w fireball Fluffy_Pillow 47078.0/50000: 94% mana heating_up, gladiators_badge
2:30.772 standard_rotation w fireball Fluffy_Pillow 47818.0/50000: 96% mana heating_up, gladiators_badge
2:32.514 standard_rotation t phoenix_flames Fluffy_Pillow 48560.0/50000: 97% mana fireball
2:33.675 standard_rotation w fireball Fluffy_Pillow 49721.0/50000: 99% mana fireball(2)
2:35.417 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:36.717 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:37.159 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:38.323 standard_rotation w fireball Fluffy_Pillow 49106.0/50000: 98% mana fireball
2:40.062 standard_rotation w fireball Fluffy_Pillow 49002.0/50000: 98% mana fireball
2:41.804 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2)
2:43.547 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(3)
2:45.289 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(4)
2:47.032 standard_rotation w fireball Fluffy_Pillow 49006.0/50000: 98% mana fireball(5)
2:48.332 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
2:48.774 default O rune_of_power Fluffy_Pillow 48942.0/50000: 98% mana hot_streak
2:49.937 rop_phase g pyroblast Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak, rune_of_power
2:51.099 rop_phase n fireball Fluffy_Pillow 50000.0/50000: 100% mana fireball, rune_of_power
2:52.841 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball, rune_of_power
2:54.583 rop_phase n fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), rune_of_power
2:54.783 rop_phase h fire_blast Fluffy_Pillow 49205.0/50000: 98% mana fireball(2), rune_of_power
2:56.324 rop_phase g pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak, rune_of_power
2:57.487 rop_phase n fireball Fluffy_Pillow 49167.0/50000: 98% mana fireball, heating_up, rune_of_power
2:58.787 rop_phase i fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up, rune_of_power
2:59.229 rop_phase g pyroblast Fluffy_Pillow 48942.0/50000: 98% mana fireball, hot_streak, rune_of_power
3:00.391 rop_phase n fireball Fluffy_Pillow 49104.0/50000: 98% mana fireball(2), heating_up, rune_of_power
3:02.133 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball(2), heating_up
3:03.874 standard_rotation p pyroblast Fluffy_Pillow 49004.0/50000: 98% mana hot_streak
3:05.037 standard_rotation w fireball Fluffy_Pillow 49167.0/50000: 98% mana fireball
3:06.779 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:08.520 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(2)
3:10.261 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana fireball(3)
3:11.561 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana heating_up
3:12.002 standard_rotation p pyroblast Fluffy_Pillow 48941.0/50000: 98% mana hot_streak
3:13.164 standard_rotation w fireball Fluffy_Pillow 49103.0/50000: 98% mana fireball, heating_up
3:14.464 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana fireball, heating_up
3:14.906 standard_rotation p pyroblast Fluffy_Pillow 48942.0/50000: 98% mana fireball, hot_streak
3:16.069 standard_rotation w fireball Fluffy_Pillow 49105.0/50000: 98% mana heating_up
3:17.811 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana heating_up
3:19.553 standard_rotation w fireball Fluffy_Pillow 49005.0/50000: 98% mana fireball
3:21.294 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:23.034 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
3:24.774 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana heating_up
3:26.514 standard_rotation w fireball Fluffy_Pillow 49003.0/50000: 98% mana fireball
3:28.255 standard_rotation w fireball Fluffy_Pillow 49004.0/50000: 98% mana heating_up
3:29.997 combustion_phase c fireball Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
3:31.297 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana fireball, hot_streak
3:31.740 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44443.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power
3:31.740 combustion_phase Z pyroblast Fluffy_Pillow 44443.0/50000: 89% mana combustion, fireball, hot_streak, rune_of_power, gladiators_badge
3:32.902 combustion_phase Z pyroblast Fluffy_Pillow 44605.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:32.902 combustion_phase U fire_blast Fluffy_Pillow 43605.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
3:34.063 combustion_phase Z pyroblast Fluffy_Pillow 44266.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:34.063 combustion_phase U fire_blast Fluffy_Pillow 43266.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
3:35.225 combustion_phase Z pyroblast Fluffy_Pillow 43928.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:35.225 combustion_phase U fire_blast Fluffy_Pillow 42928.0/50000: 86% mana combustion, rune_of_power, gladiators_badge
3:36.386 combustion_phase Z pyroblast Fluffy_Pillow 43589.0/50000: 87% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:37.548 combustion_phase b phoenix_flames Fluffy_Pillow 43751.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
3:38.711 combustion_phase Z pyroblast Fluffy_Pillow 44914.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:39.874 combustion_phase b phoenix_flames Fluffy_Pillow 45077.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
3:41.036 combustion_phase Z pyroblast Fluffy_Pillow 46239.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:41.036 combustion_phase U fire_blast Fluffy_Pillow 45239.0/50000: 90% mana combustion, rune_of_power, gladiators_badge
3:42.198 combustion_phase Z pyroblast Fluffy_Pillow 45901.0/50000: 92% mana combustion, hot_streak, rune_of_power, gladiators_badge
3:43.360 default O rune_of_power Fluffy_Pillow 46063.0/50000: 92% mana heating_up, gladiators_badge
3:44.522 rop_phase m scorch Fluffy_Pillow 47225.0/50000: 94% mana heating_up, rune_of_power, gladiators_badge
3:45.684 rop_phase k pyroblast Fluffy_Pillow 47887.0/50000: 96% mana heating_up, rune_of_power, gladiators_badge
3:46.857 rop_phase m scorch Fluffy_Pillow 48060.0/50000: 96% mana heating_up, rune_of_power
3:48.018 rop_phase k pyroblast Fluffy_Pillow 48721.0/50000: 97% mana heating_up, rune_of_power
3:48.739 rop_phase h fire_blast Fluffy_Pillow 48433.0/50000: 97% mana rune_of_power
3:49.194 rop_phase l phoenix_flames Fluffy_Pillow 48397.0/50000: 97% mana heating_up, rune_of_power
3:50.357 rop_phase m scorch Fluffy_Pillow 49560.0/50000: 99% mana rune_of_power
3:51.518 rop_phase m scorch Fluffy_Pillow 49503.0/50000: 99% mana rune_of_power
3:52.682 default N use_item_dreadfire_vessel Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
3:52.682 rop_phase k pyroblast Fluffy_Pillow 49506.0/50000: 99% mana heating_up, rune_of_power
3:53.853 rop_phase f pyroblast Fluffy_Pillow 49677.0/50000: 99% mana heating_up, rune_of_power, firestorm
3:55.015 rop_phase f pyroblast Fluffy_Pillow 49839.0/50000: 100% mana hot_streak, rune_of_power, firestorm
3:56.177 rop_phase f pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power, firestorm
3:56.460 rop_phase i fire_blast Fluffy_Pillow 49200.0/50000: 98% mana heating_up, rune_of_power, firestorm
3:57.339 standard_rotation o pyroblast Fluffy_Pillow 49662.0/50000: 99% mana hot_streak, firestorm
3:58.502 standard_rotation o pyroblast Fluffy_Pillow 49825.0/50000: 100% mana heating_up, firestorm
3:59.664 standard_rotation q pyroblast Fluffy_Pillow 49987.0/50000: 100% mana hot_streak
4:00.827 default M mirror_image Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:01.990 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana heating_up
4:03.152 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:04.324 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana heating_up
4:04.324 standard_rotation r fire_blast Fluffy_Pillow 49676.0/50000: 99% mana heating_up
4:05.485 standard_rotation q pyroblast Fluffy_Pillow 49503.0/50000: 99% mana hot_streak
4:06.647 standard_rotation v scorch Fluffy_Pillow 49665.0/50000: 99% mana
4:07.808 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:08.971 standard_rotation s pyroblast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:10.144 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
4:11.306 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:12.469 standard_rotation r fire_blast Fluffy_Pillow 49505.0/50000: 99% mana heating_up
4:12.469 standard_rotation q pyroblast Fluffy_Pillow 49005.0/50000: 98% mana hot_streak
4:13.632 standard_rotation v scorch Fluffy_Pillow 49168.0/50000: 98% mana
4:14.793 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:15.955 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:17.127 standard_rotation v scorch Fluffy_Pillow 49676.0/50000: 99% mana
4:18.288 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:19.450 standard_rotation r fire_blast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:19.623 standard_rotation q pyroblast Fluffy_Pillow 49177.0/50000: 98% mana hot_streak
4:20.786 standard_rotation v scorch Fluffy_Pillow 49340.0/50000: 99% mana
4:21.948 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:23.110 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:24.285 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:25.448 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:26.610 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:27.784 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana heating_up
4:28.945 standard_rotation r fire_blast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:28.945 standard_rotation q pyroblast Fluffy_Pillow 49003.0/50000: 98% mana hot_streak
4:30.108 standard_rotation v scorch Fluffy_Pillow 49166.0/50000: 98% mana
4:31.271 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana
4:32.432 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:33.608 standard_rotation v scorch Fluffy_Pillow 49679.0/50000: 99% mana
4:34.769 standard_rotation v scorch Fluffy_Pillow 49503.0/50000: 99% mana
4:35.930 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
4:37.104 standard_rotation v scorch Fluffy_Pillow 49677.0/50000: 99% mana
4:38.266 standard_rotation v scorch Fluffy_Pillow 49504.0/50000: 99% mana
4:39.428 standard_rotation s pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up
4:40.603 standard_rotation o pyroblast Fluffy_Pillow 49679.0/50000: 99% mana heating_up, firestorm
4:41.767 standard_rotation o pyroblast Fluffy_Pillow 49843.0/50000: 100% mana hot_streak, firestorm
4:42.929 combustion_phase Y pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
4:44.092 combustion_phase c fireball Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:45.392 combustion_phase W combustion Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
4:45.836 combustion_cooldowns T use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44444.0/50000: 89% mana combustion, hot_streak, rune_of_power
4:45.836 combustion_phase Z pyroblast Fluffy_Pillow 44444.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:46.998 combustion_phase Z pyroblast Fluffy_Pillow 44606.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:46.998 combustion_phase U fire_blast Fluffy_Pillow 43606.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
4:48.160 combustion_phase Z pyroblast Fluffy_Pillow 44268.0/50000: 89% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:48.160 combustion_phase U fire_blast Fluffy_Pillow 43268.0/50000: 87% mana combustion, rune_of_power, gladiators_badge
4:49.323 combustion_phase Z pyroblast Fluffy_Pillow 43931.0/50000: 88% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:50.486 combustion_phase b phoenix_flames Fluffy_Pillow 44094.0/50000: 88% mana combustion, heating_up, rune_of_power, gladiators_badge
4:51.648 combustion_phase Z pyroblast Fluffy_Pillow 45256.0/50000: 91% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:51.648 combustion_phase U fire_blast Fluffy_Pillow 44256.0/50000: 89% mana combustion, rune_of_power, gladiators_badge
4:52.810 combustion_phase Z pyroblast Fluffy_Pillow 44918.0/50000: 90% mana combustion, hot_streak, rune_of_power, gladiators_badge
4:53.973 combustion_phase b phoenix_flames Fluffy_Pillow 45081.0/50000: 90% mana combustion, heating_up, rune_of_power, gladiators_badge
4:55.134 combustion_phase Z pyroblast Fluffy_Pillow 46242.0/50000: 92% mana combustion, hot_streak, rune_of_power, firestorm, gladiators_badge
4:56.295 combustion_phase Y pyroblast Fluffy_Pillow 46403.0/50000: 93% mana combustion, heating_up, rune_of_power, firestorm, gladiators_badge
4:57.458 default O rune_of_power Fluffy_Pillow 46566.0/50000: 93% mana hot_streak, firestorm, gladiators_badge
4:58.620 rop_phase g pyroblast Fluffy_Pillow 47728.0/50000: 95% mana hot_streak, rune_of_power, gladiators_badge
4:58.620 rop_phase h fire_blast Fluffy_Pillow 46728.0/50000: 93% mana rune_of_power, gladiators_badge
4:59.781 rop_phase m scorch Fluffy_Pillow 47389.0/50000: 95% mana hot_streak, rune_of_power, gladiators_badge
5:00.942 rop_phase g pyroblast Fluffy_Pillow 48050.0/50000: 96% mana hot_streak, rune_of_power
5:02.104 rop_phase m scorch Fluffy_Pillow 48212.0/50000: 96% mana rune_of_power
5:03.267 rop_phase m scorch Fluffy_Pillow 48875.0/50000: 98% mana rune_of_power
5:04.429 rop_phase k pyroblast Fluffy_Pillow 49504.0/50000: 99% mana heating_up, rune_of_power
5:05.601 rop_phase m scorch Fluffy_Pillow 49676.0/50000: 99% mana rune_of_power
5:05.949 rop_phase h fire_blast Fluffy_Pillow 49976.0/50000: 100% mana rune_of_power
5:06.762 rop_phase k pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up, rune_of_power
5:07.935 rop_phase f pyroblast Fluffy_Pillow 49676.0/50000: 99% mana heating_up, rune_of_power, firestorm
5:09.097 rop_phase f pyroblast Fluffy_Pillow 49838.0/50000: 100% mana hot_streak, rune_of_power, firestorm
5:10.260 rop_phase f pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, rune_of_power, firestorm
5:11.424 standard_rotation o pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak, firestorm
5:12.586 standard_rotation o pyroblast Fluffy_Pillow 50000.0/50000: 100% mana heating_up, firestorm
5:13.750 standard_rotation q pyroblast Fluffy_Pillow 50000.0/50000: 100% mana hot_streak
5:14.913 standard_rotation t phoenix_flames Fluffy_Pillow 50000.0/50000: 100% mana
5:16.076 standard_rotation v scorch Fluffy_Pillow 50000.0/50000: 100% mana
5:16.076 standard_rotation r fire_blast Fluffy_Pillow 50000.0/50000: 100% mana
5:17.237 standard_rotation s pyroblast Fluffy_Pillow 49503.0/50000: 99% mana heating_up
5:18.412 standard_rotation v scorch Fluffy_Pillow 49678.0/50000: 99% mana
5:19.575 standard_rotation v scorch Fluffy_Pillow 49505.0/50000: 99% mana

Stats

Level Bonus (60) Race Bonus (worgen) Raid-Buffed Unbuffed Gear Amount
Strength 198 2 200 200 0
Agility 306 1 307 307 0
Stamina 414 0 2018 1922 1508
Intellect 450 -3 1813 1632 1108 (132)
Spirit 0 0 0 0 0
Health 40360 38440 0
Mana 50000 50000 0
Spell Power 1813 1632 0
Melee Crit 10.46% 10.46% 156
Spell Crit 25.46% 25.46% 156
Haste 29.52% 29.52% 974
Versatility 7.25% 7.25% 290
Mana Regen 1000 1000 0
Mastery 17.25% 17.25% 525
Armor 371 371 371
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Sin Stained Pendant
ilevel: 210, stats: { +68 Sta, +135 Haste, +54 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +30 StrAgiInt }
Local Waist Shadewarped Sash
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +32 Crit, +74 Haste }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Sparkling Glass Slippers
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +30 Crit, +75 Vers }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Haste }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Haste, +115 Vers }, enchant: { +16 Haste }
item effects: { equip: Firestorm }
Local Trinket1 Dreadfire Vessel
ilevel: 233, stats: { +83 StrAgiInt }
item effects: { use: Dreadfire Vessel }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Crest of the Legionnaire General
ilevel: 233, stats: { 42 Armor, +91 Sta, +57 Haste, +25 Vers, +49 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="worgen"
source=default
spec=fire
level=60
race=worgen
role=spell
position=back
talents=3031021
talent_override=flame_patch,if=1>2

# Default consumables
potion=spectral_intellect
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_intellect
# If set to a non-zero value, the Combustion action and cooldowns that are constrained to only be used when Combustion is up will not be used during the simulation.
actions.precombat+=/variable,name=disable_combustion,op=reset
# This variable specifies the number of targets at which Hot Streak Flamestrikes outside of Combustion should be used.
actions.precombat+=/variable,name=hot_streak_flamestrike,op=set,if=variable.hot_streak_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hard Cast Flamestrikes outside of Combustion should be used as filler.
actions.precombat+=/variable,name=hard_cast_flamestrike,op=set,if=variable.hard_cast_flamestrike=0,value=2*talent.flame_patch.enabled+3*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Hot Streak Flamestrikes are used during Combustion.
actions.precombat+=/variable,name=combustion_flamestrike,op=set,if=variable.combustion_flamestrike=0,value=3*talent.flame_patch.enabled+6*!talent.flame_patch.enabled
# This variable specifies the number of targets at which Arcane Explosion outside of Combustion should be used.
actions.precombat+=/variable,name=arcane_explosion,op=set,if=variable.arcane_explosion=0,value=99*talent.flame_patch.enabled+2*!talent.flame_patch.enabled
# This variable specifies the percentage of mana below which Arcane Explosion will not be used.
actions.precombat+=/variable,name=arcane_explosion_mana,default=40,op=reset
# With Kindling, Combustion's cooldown will be reduced by a random amount, but the number of crits starts very high after activating Combustion and slows down towards the end of Combustion's cooldown. When making decisions in the APL, Combustion's remaining cooldown is reduced by this fraction to account for Kindling.
actions.precombat+=/variable,name=kindling_reduction,default=0.2,op=reset
# The amount of cooldown reduction in seconds given by a full channel of Shifting Power. The dbc.effect.815503.base_value%1000 expression gives the number of seconds removed by each tick normally and conduit.discipline_of_the_grove.time_value gives the additional adjustment from that conduit.
actions.precombat+=/variable,name=shifting_power_reduction,op=set,value=-action.shifting_power.execute_time%action.shifting_power.new_tick_time*(dbc.effect.815503.base_value%1000+conduit.discipline_of_the_grove.time_value),if=covenant.night_fae.enabled
# The duration of a Sun King's Blessing Combustion.
actions.precombat+=/variable,name=skb_duration,op=set,value=dbc.effect.828420.base_value
actions.precombat+=/variable,name=combustion_on_use,op=set,value=equipped.macabre_sheet_music|equipped.manifesto_of_madness|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.ignition_mages_fuse|equipped.tzanes_barkspines|equipped.azurethos_singed_plumage|equipped.ancient_knot_of_wisdom|equipped.shockbiters_fang|equipped.neural_synapse_enhancer|equipped.balefire_branch
actions.precombat+=/variable,name=font_double_on_use,op=set,value=equipped.azsharas_font_of_power&variable.combustion_on_use
actions.precombat+=/variable,name=on_use_cutoff,op=set,value=20*variable.combustion_on_use+5*equipped.macabre_sheet_music
# This variable determines when Azshara's Font of Power is used before the pull if bfa.font_of_power_precombat_channel is not specified.
actions.precombat+=/variable,name=font_of_power_precombat_channel,op=set,value=18,if=variable.font_double_on_use&!talent.firestarter.enabled&variable.font_of_power_precombat_channel=0
# How long before Combustion should Empyreal Ordnance be used?
actions.precombat+=/variable,name=empyreal_ordnance_delay,default=18,op=reset
actions.precombat+=/snapshot_stats
actions.precombat+=/use_item,name=azsharas_font_of_power,if=!variable.disable_combustion
actions.precombat+=/mirror_image
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=!runeforge.disciplinary_command.equipped
actions+=/variable,name=time_to_combustion,op=set,value=talent.firestarter.enabled*firestarter.remains+(cooldown.combustion.remains*(1-variable.kindling_reduction*talent.kindling.enabled))*!cooldown.combustion.ready*buff.combustion.down
# Make sure Combustion is delayed if needed based on the empyreal_ordnance_delay variable
actions+=/variable,name=time_to_combustion,op=max,value=variable.empyreal_ordnance_delay-(cooldown.empyreal_ordnance.duration-cooldown.empyreal_ordnance.remains)*!cooldown.empyreal_ordnance.ready,if=equipped.empyreal_ordnance
actions+=/shifting_power,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains>0
actions+=/radiant_spark,if=(buff.combustion.down&buff.rune_of_power.down&(cooldown.combustion.remains<execute_time|cooldown.combustion.remains>cooldown.radiant_spark.duration))|(buff.rune_of_power.up&cooldown.combustion.remains>30)
actions+=/deathborne,if=buff.combustion.down&buff.rune_of_power.down&cooldown.combustion.remains<execute_time
actions+=/mirror_image,if=buff.combustion.down&debuff.radiant_spark_vulnerability.down
actions+=/use_item,effect_name=gladiators_badge,if=variable.time_to_combustion>cooldown-5
actions+=/use_item,name=empyreal_ordnance,if=variable.time_to_combustion<=variable.empyreal_ordnance_delay
actions+=/use_item,name=soul_igniter,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=glyph_of_assimilation,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=macabre_sheet_music,if=variable.time_to_combustion<=5
actions+=/use_item,name=dreadfire_vessel,if=variable.time_to_combustion>=variable.on_use_cutoff
actions+=/use_item,name=azsharas_font_of_power,if=variable.time_to_combustion<=5+15*variable.font_double_on_use&variable.time_to_combustion>0&!variable.disable_combustion
actions+=/guardian_of_azeroth,if=(variable.time_to_combustion<10|fight_remains<variable.time_to_combustion)&!variable.disable_combustion
actions+=/concentrated_flame
actions+=/reaping_flames
actions+=/focused_azerite_beam
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force
# Get the disciplinary_command buff up, unless combustion is soon.
actions+=/counterspell,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_arcane.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&cooldown.combustion.remains>30&!buff.disciplinary_command.up
actions+=/rune_of_power,if=buff.rune_of_power.down&(variable.time_to_combustion>buff.rune_of_power.duration&variable.time_to_combustion>action.fire_blast.full_recharge_time|variable.time_to_combustion>fight_remains|variable.disable_combustion)
actions+=/call_action_list,name=combustion_phase,if=!variable.disable_combustion&variable.time_to_combustion<=0
actions+=/variable,name=fire_blast_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.fire_blast.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains
actions+=/variable,name=phoenix_pooling,value=!variable.disable_combustion&variable.time_to_combustion<action.phoenix_flames.full_recharge_time-variable.shifting_power_reduction*(cooldown.shifting_power.remains<variable.time_to_combustion)&variable.time_to_combustion<fight_remains|runeforge.sun_kings_blessing.equipped
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&(variable.time_to_combustion>0|variable.disable_combustion)
# When Hardcasting Flame Strike, Fire Blasts should be used to generate Hot Streaks and to extend Blaster Master.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!variable.fire_blast_pooling&(variable.time_to_combustion>0|variable.disable_combustion)&active_enemies>=variable.hard_cast_flamestrike&!firestarter.active&!buff.hot_streak.react&(buff.heating_up.react&action.flamestrike.execute_remains<0.5|charges_fractional>=2)
# During Firestarter, Fire Blasts are used similarly to during Combustion. Generally, they are used to generate Hot Streaks when crits will not be wasted and with Blaster Master, they should be spread out to maintain the Blaster Master buff.
actions+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=firestarter.active&charges>=1&!variable.fire_blast_pooling&(!action.fireball.executing&!action.pyroblast.in_flight&buff.heating_up.react|action.fireball.executing&!buff.hot_streak.react|action.pyroblast.in_flight&buff.heating_up.react&!buff.hot_streak.react)
actions+=/call_action_list,name=standard_rotation,if=(variable.time_to_combustion>0|variable.disable_combustion)&buff.rune_of_power.down

actions.active_talents=living_bomb,if=active_enemies>1&buff.combustion.down&(variable.time_to_combustion>cooldown.living_bomb.duration|variable.time_to_combustion<=0|variable.disable_combustion)
actions.active_talents+=/meteor,if=!variable.disable_combustion&variable.time_to_combustion<=0|(cooldown.meteor.duration<variable.time_to_combustion&!talent.rune_of_power.enabled)|talent.rune_of_power.enabled&buff.rune_of_power.up&variable.time_to_combustion>action.meteor.cooldown|fight_remains<variable.time_to_combustion|variable.disable_combustion
actions.active_talents+=/dragons_breath,if=talent.alexstraszas_fury.enabled&(buff.combustion.down&!buff.hot_streak.react)

actions.combustion_cooldowns=potion
actions.combustion_cooldowns+=/blood_fury
actions.combustion_cooldowns+=/berserking
actions.combustion_cooldowns+=/fireblood
actions.combustion_cooldowns+=/ancestral_call
actions.combustion_cooldowns+=/use_items
actions.combustion_cooldowns+=/use_item,use_off_gcd=1,effect_name=gladiators_badge,if=action.meteor.in_flight_remains<=0.5
actions.combustion_cooldowns+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up

actions.combustion_phase=lights_judgment,if=buff.combustion.down
# Estimate how long Combustion will last thanks to Sun King's Blessing to determine how Fire Blasts should be used.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=set,value=buff.combustion.remains+buff.combustion.duration*(cooldown.combustion.remains<buff.combustion.remains)
# Adds the duration of the Sun King's Blessing Combustion to the end of the current Combustion if the cast would complete during this Combustion.
actions.combustion_phase+=/variable,name=extended_combustion_remains,op=add,value=variable.skb_duration,if=buff.sun_kings_blessing_ready.up|variable.extended_combustion_remains>1.5*gcd.max*(buff.sun_kings_blessing.max_stack-buff.sun_kings_blessing.stack)
actions.combustion_phase+=/bag_of_tricks,if=buff.combustion.down
actions.combustion_phase+=/living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase+=/mirrors_of_torment,if=buff.combustion.down&buff.rune_of_power.down
actions.combustion_phase+=/use_item,name=hyperthread_wristwraps,if=buff.combustion.up&action.fire_blast.charges=0&action.fire_blast.recharge_time>gcd.max
actions.combustion_phase+=/blood_of_the_enemy
actions.combustion_phase+=/memory_of_lucid_dreams
actions.combustion_phase+=/worldvein_resonance
# BFA Fire Blast usage: During Combustion, Fire Blasts are used to generate Hot Streaks and minimize the amount of time spent executing other spells. For standard Fire, Fire Blasts are only used when Heating Up is active or when a Scorch cast is in progress and Heating Up and Hot Streak are not active. With Blaster Master and Flame On, Fire Blasts can additionally be used while Hot Streak and Heating Up are not active and a Pyroblast is in the air and also while casting Scorch even if Heating Up is already active. The latter allows two Hot Streak Pyroblasts to be cast in succession after the Scorch. Additionally with Blaster Master and Flame On, Fire Blasts should not be used unless Blaster Master is about to expire or there are more than enough Fire Blasts to extend Blaster Master to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&conduit.infernal_cascade.enabled&charges>=1&((action.fire_blast.charges_fractional+(variable.extended_combustion_remains-buff.infernal_cascade.duration)%cooldown.fire_blast.duration-variable.extended_combustion_remains%(buff.infernal_cascade.duration-0.5))>=0|variable.extended_combustion_remains<=buff.infernal_cascade.duration|buff.infernal_cascade.remains<0.5)&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
# Without Infernal Cascade, just use Fire Blasts when they won't munch crits and when Firestorm is down.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=azerite.blaster_master.enabled&charges>=1&((action.fire_blast.charges_fractional+(buff.combustion.remains-buff.blaster_master.duration)%cooldown.fire_blast.duration-(buff.combustion.remains)%(buff.blaster_master.duration-0.5))>=0|!azerite.blaster_master.enabled|!talent.flame_on.enabled|buff.combustion.remains<=buff.blaster_master.duration|buff.blaster_master.remains<0.5|equipped.hyperthread_wristwraps&cooldown.hyperthread_wristwraps_300142.remains<5)&buff.combustion.up&(!action.scorch.executing&!action.pyroblast.in_flight&buff.heating_up.up|action.scorch.executing&buff.hot_streak.down&(buff.heating_up.down|azerite.blaster_master.enabled)|azerite.blaster_master.enabled&talent.flame_on.enabled&action.pyroblast.in_flight&buff.heating_up.down&buff.hot_streak.down)
# With Infernal Cascade, Fire Blast use should be additionaly constrained so that it is not be used unless Infernal Cascade is about to expire or there are more than enough Fire Blasts to extend Infernal Cascade to the end of Combustion.
actions.combustion_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!azerite.blaster_master.enabled&(active_enemies<=active_dot.ignite|!cooldown.phoenix_flames.ready)&!conduit.infernal_cascade.enabled&charges>=1&buff.combustion.up&!buff.firestorm.react&!buff.hot_streak.react&hot_streak_spells_in_flight+buff.heating_up.react<2
actions.combustion_phase+=/counterspell,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/arcane_explosion,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_arcane.down&cooldown.buff_disciplinary_command.ready
actions.combustion_phase+=/frostbolt,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command.down&buff.disciplinary_command_frost.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion,use_off_gcd=1,use_while_casting=1,if=buff.combustion.down&(runeforge.disciplinary_command.equipped=buff.disciplinary_command.up)&(action.meteor.in_flight&action.meteor.in_flight_remains<=0.5|action.scorch.executing&action.scorch.execute_remains<0.5|action.fireball.executing&action.fireball.execute_remains<0.5|action.pyroblast.executing&action.pyroblast.execute_remains<0.5)
# Other cooldowns that should be used with Combustion should only be used with an actual Combustion cast and not with a Sun King's Blessing proc.
actions.combustion_phase+=/call_action_list,name=combustion_cooldowns,if=buff.combustion.last_expire<=action.combustion.last_used
actions.combustion_phase+=/flamestrike,if=(buff.hot_streak.react|buff.firestorm.react)&active_enemies>=variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.combustion_phase+=/pyroblast,if=buff.firestorm.react
actions.combustion_phase+=/pyroblast,if=buff.pyroclasm.react&buff.pyroclasm.remains>cast_time&(buff.combustion.remains>cast_time|buff.combustion.down)&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.react&buff.combustion.up
actions.combustion_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&active_enemies<variable.combustion_flamestrike
actions.combustion_phase+=/phoenix_flames,if=buff.combustion.up&((action.fire_blast.charges<1&talent.pyroclasm.enabled&active_enemies=1)|!talent.pyroclasm.enabled|active_enemies>1)
actions.combustion_phase+=/fireball,if=buff.combustion.down&cooldown.combustion.remains<cast_time&!conduit.flame_accretion.enabled
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time&buff.combustion.up|buff.combustion.down&cooldown.combustion.remains<cast_time
actions.combustion_phase+=/living_bomb,if=buff.combustion.remains<gcd.max&active_enemies>1
actions.combustion_phase+=/dragons_breath,if=buff.combustion.remains<gcd.max&buff.combustion.up
actions.combustion_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled

actions.rop_phase=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.rop_phase+=/pyroblast,if=buff.sun_kings_blessing_ready.up&buff.sun_kings_blessing_ready.remains>cast_time
actions.rop_phase+=/pyroblast,if=buff.firestorm.react
actions.rop_phase+=/pyroblast,if=buff.hot_streak.react
# Use one Fire Blast early in RoP if you don't have either Heating Up or Hot Streak yet and either: (a) have more than two already, (b) have Alexstrasza's Fury ready to use, or (c) Searing Touch is active. Don't do this while hard casting Flametrikes or when Sun King's Blessing is ready.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=buff.sun_kings_blessing_ready.down&active_enemies<variable.hard_cast_flamestrike&!firestarter.active&(!buff.heating_up.react&!buff.hot_streak.react&!prev_off_gcd.fire_blast&(action.fire_blast.charges>=2|(talent.alexstraszas_fury.enabled&cooldown.dragons_breath.ready)|(talent.searing_touch.enabled&target.health.pct<=30)))
# Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.rop_phase+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains&cast_time<buff.rune_of_power.remains
actions.rop_phase+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.rop_phase+=/phoenix_flames,if=!variable.phoenix_pooling&buff.heating_up.react&!buff.hot_streak.react&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.rop_phase+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
actions.rop_phase+=/dragons_breath,if=active_enemies>2
actions.rop_phase+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.rop_phase+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.rop_phase+=/fireball

actions.standard_rotation=flamestrike,if=active_enemies>=variable.hot_streak_flamestrike&(buff.hot_streak.react|buff.firestorm.react)
actions.standard_rotation+=/pyroblast,if=buff.firestorm.react
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&buff.hot_streak.remains<action.fireball.execute_time
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&(prev_gcd.1.fireball|firestarter.active|action.pyroblast.in_flight)
# Try to get SKB procs inside RoP phases or Combustion phases when possible.
actions.standard_rotation+=/pyroblast,if=buff.sun_kings_blessing_ready.up&(cooldown.rune_of_power.remains+action.rune_of_power.execute_time+cast_time>buff.sun_kings_blessing_ready.remains|!talent.rune_of_power.enabled)&variable.time_to_combustion+cast_time>buff.sun_kings_blessing_ready.remains
actions.standard_rotation+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=30&talent.searing_touch.enabled
actions.standard_rotation+=/pyroblast,if=buff.pyroclasm.react&cast_time<buff.pyroclasm.remains
# During the standard rotation, only use Fire Blasts when they are not being pooled for RoP or Combustion. Use Fire Blast either during a Fireball/Pyroblast cast when Heating Up is active or during execute with Searing Touch.
actions.standard_rotation+=/fire_blast,use_off_gcd=1,use_while_casting=1,if=!firestarter.active&!variable.fire_blast_pooling&(((action.fireball.executing&(action.fireball.execute_remains<0.5|!runeforge.firestorm.equipped)|action.pyroblast.executing&(action.pyroblast.execute_remains<0.5|!runeforge.firestorm.equipped))&buff.heating_up.react)|(talent.searing_touch.enabled&target.health.pct<=30&(buff.heating_up.react&!action.scorch.executing|!buff.hot_streak.react&!buff.heating_up.react&action.scorch.executing&!hot_streak_spells_in_flight)))
actions.standard_rotation+=/pyroblast,if=prev_gcd.1.scorch&buff.heating_up.react&talent.searing_touch.enabled&target.health.pct<=30&active_enemies<variable.hot_streak_flamestrike
actions.standard_rotation+=/phoenix_flames,if=!variable.phoenix_pooling&(!talent.from_the_ashes.enabled|active_enemies>1)&(active_dot.ignite<2|active_enemies>=variable.hard_cast_flamestrike|active_enemies>=variable.hot_streak_flamestrike)
actions.standard_rotation+=/call_action_list,name=active_talents
actions.standard_rotation+=/dragons_breath,if=active_enemies>1
actions.standard_rotation+=/scorch,if=target.health.pct<=30&talent.searing_touch.enabled
# With enough targets, it is a gain to cast Flamestrike as filler instead of Fireball.
actions.standard_rotation+=/arcane_explosion,if=active_enemies>=variable.arcane_explosion&mana.pct>=variable.arcane_explosion_mana
actions.standard_rotation+=/flamestrike,if=active_enemies>=variable.hard_cast_flamestrike
actions.standard_rotation+=/fireball
actions.standard_rotation+=/scorch

head=confidants_favored_cap,id=183021,bonus_id=1498/6646
neck=sin_stained_pendant,id=178827,bonus_id=1524/6646
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498/6646
back=crest_of_the_legionnaire_general,id=183032,bonus_id=1498/6646
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498/6646,enchant_id=6230
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498/6646,enchant_id=6220
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498/6646
waist=shadewarped_sash,id=183004,bonus_id=1498/6646
legs=courtiers_costume_trousers,id=183011,bonus_id=1498/6646
feet=sparkling_glass_slippers,id=183023,bonus_id=1498/6646
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498/6646,enchant_id=6166
finger2=shadowghast_ring,id=178926,bonus_id=6716/6932/6649/6650/1532,enchant_id=6166
trinket1=dreadfire_vessel,id=184030,bonus_id=1498/6646
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521/6646
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531/6646,enchant_id=6228

# Gear Summary
# gear_ilvl=227.07
# gear_stamina=1508
# gear_intellect=1108
# gear_crit_rating=142
# gear_haste_rating=974
# gear_mastery_rating=525
# gear_versatility_rating=290
# gear_armor=371

Simulation & Raid Information

Iterations: 1733
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.5 )

Performance:

Total Events Processed: 114738568
Max Event Queue: 608
Sim Seconds: 520730
CPU Seconds: 255.7813
Physical Seconds: 20.6178
Speed Up: 2036

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
dark_iron_dwarf dark_iron_dwarf combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.81sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf conflagration_flare_up 205345 7242 24 6.01 150 383 30.1 30.1 38.9% 0.0% 0.0% 0.0% 9.56sec 7242 300.48sec
dark_iron_dwarf dark_iron_dwarf dragons_breath 31661 3262 11 0.17 0 3900 0.8 0.8 100.0% 0.0% 0.0% 0.0% 90.17sec 3262 300.48sec
dark_iron_dwarf dark_iron_dwarf dreadfire_vessel 344732 47807 159 0.66 11655 23301 3.3 3.3 24.4% 0.0% 0.0% 0.0% 103.76sec 47807 300.48sec
dark_iron_dwarf dark_iron_dwarf fire_blast 108853 182845 609 8.45 0 4322 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.14sec 182845 300.48sec
dark_iron_dwarf dark_iron_dwarf fireball 133 184052 613 15.48 1654 3459 77.5 77.5 39.9% 0.0% 0.0% 0.0% 3.41sec 184052 300.48sec
dark_iron_dwarf dark_iron_dwarf conflagration ticks -226757 8552 29 28.69 35 92 77.5 143.5 42.7% 0.0% 0.0% 0.0% 3.40sec 8552 300.48sec
dark_iron_dwarf dark_iron_dwarf fireblood 265221 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 146.58sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf ignite ticks -12654 291124 970 59.84 973 0 264.6 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 291124 300.48sec
dark_iron_dwarf dark_iron_dwarf mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.43sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf_mirror_image frostbolt 59638 11104 98 124.82 38 76 236.0 235.3 24.4% 0.0% 0.0% 0.0% 3.45sec 11104 113.09sec
dark_iron_dwarf dark_iron_dwarf phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.64sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf phoenix_flames_splash 257542 75328 251 2.82 2095 6238 14.1 14.1 78.4% 0.0% 0.0% 0.0% 21.65sec 75328 300.48sec
dark_iron_dwarf dark_iron_dwarf potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf pyroblast 11366 621844 2070 19.37 3082 7916 96.3 97.0 68.9% 0.0% 0.0% 0.0% 3.10sec 621844 300.48sec
dark_iron_dwarf dark_iron_dwarf pyroblast_dot ticks -321712 39564 132 35.55 136 355 97.0 177.7 39.5% 0.0% 0.0% 0.0% 3.10sec 39564 300.48sec
dark_iron_dwarf dark_iron_dwarf rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.49sec 0 300.48sec
dark_iron_dwarf dark_iron_dwarf scorch 2948 63577 212 6.73 0 1887 33.7 33.7 100.0% 0.0% 0.0% 0.0% 7.77sec 63577 300.48sec
draenei draenei combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.81sec 0 300.48sec
draenei draenei conflagration_flare_up 205345 7167 24 5.97 152 380 29.9 29.9 38.4% 0.0% 0.0% 0.0% 9.82sec 7167 300.48sec
draenei draenei dragons_breath 31661 3066 10 0.16 0 3946 0.8 0.8 100.0% 0.0% 0.0% 0.0% 116.09sec 3066 300.48sec
draenei draenei dreadfire_vessel 344732 47539 158 0.66 11658 23314 3.3 3.3 24.0% 0.0% 0.0% 0.0% 103.68sec 47539 300.48sec
draenei draenei fire_blast 108853 182260 607 8.45 0 4307 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.15sec 182260 300.48sec
draenei draenei fireball 133 185655 618 15.40 1679 3496 77.1 77.1 40.1% 0.0% 0.0% 0.0% 3.42sec 185655 300.48sec
draenei draenei conflagration ticks -226757 8528 28 28.66 36 91 77.1 143.3 42.6% 0.0% 0.0% 0.0% 3.42sec 8528 300.48sec
draenei draenei flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
draenei draenei food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
draenei draenei ignite ticks -12654 290619 969 59.84 971 0 264.9 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 290619 300.48sec
draenei draenei mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.43sec 0 300.48sec
draenei draenei_mirror_image frostbolt 59638 11060 98 124.80 38 76 236.0 235.3 24.4% 0.0% 0.0% 0.0% 3.45sec 11060 113.10sec
draenei draenei phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.75sec 0 300.48sec
draenei draenei phoenix_flames_splash 257542 73292 244 2.81 2126 6055 14.1 14.1 78.3% 0.0% 0.0% 0.0% 21.71sec 73292 300.48sec
draenei draenei potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
draenei draenei pyroblast 11366 622286 2071 19.49 3125 7841 96.9 97.6 68.9% 0.0% 0.0% 0.0% 3.08sec 622286 300.48sec
draenei draenei pyroblast_dot ticks -321712 39680 132 35.61 138 353 97.6 178.1 39.5% 0.0% 0.0% 0.0% 3.07sec 39680 300.48sec
draenei draenei rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.38sec 0 300.48sec
draenei draenei scorch 2948 64332 214 6.73 0 1908 33.7 33.7 100.0% 0.0% 0.0% 0.0% 7.70sec 64332 300.48sec
dwarf dwarf combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.94sec 0 300.48sec
dwarf dwarf conflagration_flare_up 205345 7199 24 6.00 150 382 30.1 30.1 38.5% 0.0% 0.0% 0.0% 9.72sec 7199 300.48sec
dwarf dwarf dragons_breath 31661 3240 11 0.16 0 3977 0.8 0.8 100.0% 0.0% 0.0% 0.0% 104.42sec 3240 300.48sec
dwarf dwarf dreadfire_vessel 344732 48112 160 0.65 11655 23796 3.3 3.3 24.9% 0.0% 0.0% 0.0% 103.84sec 48112 300.48sec
dwarf dwarf fire_blast 108853 183406 610 8.45 0 4335 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.14sec 183406 300.48sec
dwarf dwarf fireball 133 185242 616 15.43 1655 3511 77.3 77.3 40.0% 0.0% 0.0% 0.0% 3.42sec 185242 300.48sec
dwarf dwarf conflagration ticks -226757 8542 28 28.68 35 92 77.3 143.4 42.9% 0.0% 0.0% 0.0% 3.41sec 8542 300.48sec
dwarf dwarf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
dwarf dwarf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
dwarf dwarf ignite ticks -12654 291352 971 59.84 974 0 264.7 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 291352 300.48sec
dwarf dwarf mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.36sec 0 300.48sec
dwarf dwarf_mirror_image frostbolt 59638 11003 97 124.81 37 76 236.0 235.2 24.4% 0.0% 0.0% 0.0% 3.45sec 11003 113.09sec
dwarf dwarf phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.70sec 0 300.48sec
dwarf dwarf phoenix_flames_splash 257542 73989 246 2.82 2103 6093 14.1 14.1 78.8% 0.0% 0.0% 0.0% 21.73sec 73989 300.48sec
dwarf dwarf potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
dwarf dwarf pyroblast 11366 622642 2072 19.43 3079 7894 96.6 97.3 69.0% 0.0% 0.0% 0.0% 3.11sec 622642 300.48sec
dwarf dwarf pyroblast_dot ticks -321712 39576 132 35.54 136 356 97.3 177.7 39.5% 0.0% 0.0% 0.0% 3.10sec 39576 300.48sec
dwarf dwarf rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.28sec 0 300.48sec
dwarf dwarf scorch 2948 64892 216 6.74 0 1921 33.8 33.8 100.0% 0.0% 0.0% 0.0% 7.42sec 64892 300.48sec
fire fire berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
fire fire combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.62sec 0 300.48sec
fire fire conflagration_flare_up 205345 7102 24 6.00 149 374 30.0 30.0 38.7% 0.0% 0.0% 0.0% 9.57sec 7102 300.48sec
fire fire dragons_breath 31661 6496 22 0.32 0 4051 1.6 1.6 100.0% 0.0% 0.0% 0.0% 112.74sec 6496 300.48sec
fire fire dreadfire_vessel 344732 47925 159 0.65 11650 23320 3.3 3.3 25.5% 0.0% 0.0% 0.0% 103.60sec 47925 300.48sec
fire fire fire_blast 108853 181613 604 8.51 0 4261 42.6 42.6 100.0% 0.0% 0.0% 0.0% 7.10sec 181613 300.48sec
fire fire fireball 133 183844 612 15.46 1655 3446 77.5 77.4 40.1% 0.0% 0.0% 0.0% 3.38sec 183844 300.48sec
fire fire conflagration ticks -226757 8614 29 29.03 36 90 77.4 145.1 43.5% 0.0% 0.0% 0.0% 3.37sec 8614 300.48sec
fire fire flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
fire fire food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
fire fire ignite ticks -12654 292122 974 59.84 976 0 266.7 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 292122 300.48sec
fire fire mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.47sec 0 300.48sec
fire fire_mirror_image frostbolt 59638 11119 98 126.42 38 75 238.8 238.1 24.3% 0.0% 0.0% 0.0% 3.41sec 11119 113.01sec
fire fire phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.64sec 0 300.48sec
fire fire phoenix_flames_splash 257542 72771 242 2.81 2113 5965 14.1 14.1 79.2% 0.0% 0.0% 0.0% 21.65sec 72771 300.48sec
fire fire potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
fire fire pyroblast 11366 627499 2088 19.72 3047 7779 98.1 98.8 69.9% 0.0% 0.0% 0.0% 3.07sec 627499 300.48sec
fire fire pyroblast_dot ticks -321712 39685 132 35.82 136 350 98.8 179.1 40.1% 0.0% 0.0% 0.0% 3.07sec 39685 300.48sec
fire fire rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.25sec 0 300.48sec
fire fire scorch 2948 63822 212 6.75 0 1888 33.8 33.8 100.0% 0.0% 0.0% 0.0% 7.59sec 63822 300.48sec
gnome gnome combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.09sec 0 300.48sec
gnome gnome conflagration_flare_up 205345 7088 24 5.98 150 376 29.9 29.9 38.6% 0.0% 0.0% 0.0% 9.68sec 7088 300.48sec
gnome gnome dragons_breath 31661 3290 11 0.17 0 3904 0.8 0.8 100.0% 0.0% 0.0% 0.0% 92.75sec 3290 300.48sec
gnome gnome dreadfire_vessel 344732 47234 157 0.66 11649 23350 3.3 3.3 23.4% 0.0% 0.0% 0.0% 102.96sec 47234 300.48sec
gnome gnome fire_blast 108853 182510 607 8.53 0 4271 42.7 42.7 100.0% 0.0% 0.0% 0.0% 7.08sec 182510 300.48sec
gnome gnome fireball 133 183328 610 15.41 1656 3450 77.2 77.2 40.1% 0.0% 0.0% 0.0% 3.40sec 183328 300.48sec
gnome gnome conflagration ticks -226757 8498 28 28.68 36 90 77.2 143.4 43.1% 0.0% 0.0% 0.0% 3.40sec 8498 300.48sec
gnome gnome flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
gnome gnome food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
gnome gnome ignite ticks -12654 295805 986 59.84 989 0 268.0 299.2 0.0% 0.0% 0.0% 0.0% 1.12sec 295805 300.48sec
gnome gnome mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.43sec 0 300.48sec
gnome gnome_mirror_image frostbolt 59638 11210 99 127.52 37 75 241.1 240.3 24.4% 0.0% 0.0% 0.0% 3.39sec 11210 113.07sec
gnome gnome phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.62sec 0 300.48sec
gnome gnome phoenix_flames_splash 257542 72801 242 2.82 2151 5997 14.1 14.1 78.3% 0.0% 0.0% 0.0% 21.61sec 72801 300.48sec
gnome gnome potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
gnome gnome pyroblast 11366 639603 2129 19.90 3024 7832 98.9 99.6 70.6% 0.0% 0.0% 0.0% 3.06sec 639603 300.48sec
gnome gnome pyroblast_dot ticks -321712 39656 132 35.90 137 350 99.6 179.5 39.6% 0.0% 0.0% 0.0% 3.06sec 39656 300.48sec
gnome gnome rune_of_power 116011 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 61.90sec 0 300.48sec
gnome gnome scorch 2948 64730 215 6.87 0 1882 34.4 34.4 100.0% 0.0% 0.0% 0.0% 7.70sec 64730 300.48sec
human human combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.60sec 0 300.48sec
human human conflagration_flare_up 205345 7089 24 5.97 150 374 29.9 29.9 38.7% 0.0% 0.0% 0.0% 9.90sec 7089 300.48sec
human human dragons_breath 31661 2919 10 0.15 0 3900 0.7 0.7 100.0% 0.0% 0.0% 0.0% 117.84sec 2919 300.48sec
human human dreadfire_vessel 344732 47895 159 0.66 11665 23314 3.3 3.3 24.9% 0.0% 0.0% 0.0% 103.37sec 47895 300.48sec
human human fire_blast 108853 180967 602 8.48 0 4260 42.5 42.5 100.0% 0.0% 0.0% 0.0% 7.12sec 180967 300.48sec
human human fireball 133 185092 616 15.55 1657 3448 77.9 77.9 40.2% 0.0% 0.0% 0.0% 3.40sec 185092 300.48sec
human human conflagration ticks -226757 8506 28 28.84 36 90 77.9 144.2 43.1% 0.0% 0.0% 0.0% 3.39sec 8506 300.48sec
human human flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
human human food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
human human ignite ticks -12654 292251 974 59.84 977 0 265.9 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 292251 300.48sec
human human mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.40sec 0 300.48sec
human human_mirror_image frostbolt 59638 11177 99 127.49 37 75 241.1 240.4 24.6% 0.0% 0.0% 0.0% 3.39sec 11177 113.11sec
human human phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.77sec 0 300.48sec
human human phoenix_flames_splash 257542 72623 242 2.81 2101 5986 14.1 14.1 78.6% 0.0% 0.0% 0.0% 21.73sec 72623 300.48sec
human human potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
human human pyroblast 11366 615105 2047 19.52 3090 7742 97.1 97.7 68.9% 0.0% 0.0% 0.0% 3.07sec 615105 300.48sec
human human pyroblast_dot ticks -321712 39423 131 35.72 136 349 97.7 178.6 39.6% 0.0% 0.0% 0.0% 3.06sec 39423 300.48sec
human human rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.77sec 0 300.48sec
human human scorch 2948 63729 212 6.74 0 1887 33.8 33.8 100.0% 0.0% 0.0% 0.0% 7.50sec 63729 300.48sec
kul_tiran kul_tiran combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.98sec 0 300.48sec
kul_tiran kul_tiran conflagration_flare_up 205345 7078 24 5.92 151 377 29.7 29.7 38.7% 0.0% 0.0% 0.0% 9.84sec 7078 300.48sec
kul_tiran kul_tiran dragons_breath 31661 3199 11 0.16 0 3929 0.8 0.8 100.0% 0.0% 0.0% 0.0% 113.95sec 3199 300.48sec
kul_tiran kul_tiran dreadfire_vessel 344732 47797 159 0.66 11757 23522 3.3 3.3 23.7% 0.0% 0.0% 0.0% 103.67sec 47797 300.48sec
kul_tiran kul_tiran fire_blast 108853 181429 604 8.44 0 4290 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.15sec 181429 300.48sec
kul_tiran kul_tiran fireball 133 185271 617 15.46 1670 3476 77.4 77.4 40.1% 0.0% 0.0% 0.0% 3.39sec 185271 300.48sec
kul_tiran kul_tiran conflagration ticks -226757 8519 28 28.69 36 91 77.4 143.4 42.9% 0.0% 0.0% 0.0% 3.38sec 8519 300.48sec
kul_tiran kul_tiran flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
kul_tiran kul_tiran food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
kul_tiran kul_tiran ignite ticks -12654 289090 964 59.84 966 0 264.6 299.2 0.0% 0.0% 0.0% 0.0% 1.14sec 289090 300.48sec
kul_tiran kul_tiran mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.44sec 0 300.48sec
kul_tiran kul_tiran_mirror_image frostbolt 59638 11029 98 124.82 38 75 236.0 235.3 24.5% 0.0% 0.0% 0.0% 3.45sec 11029 113.10sec
kul_tiran kul_tiran phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.64sec 0 300.48sec
kul_tiran kul_tiran phoenix_flames_splash 257542 73202 244 2.81 2109 6035 14.1 14.1 78.6% 0.0% 0.0% 0.0% 21.66sec 73202 300.48sec
kul_tiran kul_tiran potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
kul_tiran kul_tiran pyroblast 11366 617640 2056 19.40 3112 7823 96.5 97.2 68.9% 0.0% 0.0% 0.0% 3.12sec 617640 300.48sec
kul_tiran kul_tiran pyroblast_dot ticks -321712 39485 132 35.57 137 352 97.2 177.8 39.5% 0.0% 0.0% 0.0% 3.12sec 39485 300.48sec
kul_tiran kul_tiran rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 59.22sec 0 300.48sec
kul_tiran kul_tiran scorch 2948 64138 213 6.73 0 1904 33.7 33.7 100.0% 0.0% 0.0% 0.0% 7.18sec 64138 300.48sec
lightforged draenei lightforged draenei combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 71.04sec 0 300.48sec
lightforged draenei lightforged draenei conflagration_flare_up 205345 7027 23 5.96 150 374 29.9 29.9 38.2% 0.0% 0.0% 0.0% 9.74sec 7027 300.48sec
lightforged draenei lightforged draenei dragons_breath 31661 3225 11 0.17 0 3899 0.8 0.8 100.0% 0.0% 0.0% 0.0% 110.10sec 3225 300.48sec
lightforged draenei lightforged draenei dreadfire_vessel 344732 47639 159 0.65 11649 23317 3.3 3.3 24.9% 0.0% 0.0% 0.0% 103.77sec 47639 300.48sec
lightforged draenei lightforged draenei fire_blast 108853 179895 599 8.42 0 4265 42.2 42.2 100.0% 0.0% 0.0% 0.0% 7.15sec 179895 300.48sec
lightforged draenei lightforged draenei fireball 133 182543 608 15.36 1654 3445 76.9 76.9 40.1% 0.0% 0.0% 0.0% 3.43sec 182543 300.48sec
lightforged draenei lightforged draenei conflagration ticks -226757 8406 28 28.56 36 90 76.9 142.8 42.9% 0.0% 0.0% 0.0% 3.41sec 8406 300.48sec
lightforged draenei lightforged draenei flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
lightforged draenei lightforged draenei food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
lightforged draenei lightforged draenei ignite ticks -12654 285626 952 59.84 955 0 263.0 299.2 0.0% 0.0% 0.0% 0.0% 1.14sec 285626 300.48sec
lightforged draenei lightforged draenei lights_judgment 255647 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 159.05sec 0 300.48sec
lightforged draenei lightforged draenei lights_judgment_damage 256893 19351 64 0.40 7813 15617 2.0 2.0 23.6% 0.0% 0.0% 0.0% 210.06sec 19351 300.48sec
lightforged draenei lightforged draenei mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.45sec 0 300.48sec
lightforged draenei lightforged draenei_mirror_image frostbolt 59638 10912 97 124.80 37 74 236.0 235.2 24.6% 0.0% 0.0% 0.0% 3.46sec 10912 113.07sec
lightforged draenei lightforged draenei phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.68sec 0 300.48sec
lightforged draenei lightforged draenei phoenix_flames_splash 257542 72186 240 2.80 2101 5980 14.0 14.0 78.4% 0.0% 0.0% 0.0% 21.69sec 72186 300.48sec
lightforged draenei lightforged draenei potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 301.76sec 0 300.48sec
lightforged draenei lightforged draenei pyroblast 11366 610614 2032 19.32 3068 7764 96.1 96.7 69.1% 0.0% 0.0% 0.0% 3.11sec 610614 300.48sec
lightforged draenei lightforged draenei pyroblast_dot ticks -321712 39114 130 35.52 137 349 96.7 177.6 39.5% 0.0% 0.0% 0.0% 3.11sec 39114 300.48sec
lightforged draenei lightforged draenei rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.74sec 0 300.48sec
lightforged draenei lightforged draenei scorch 2948 62612 208 6.62 0 1889 33.2 33.2 100.0% 0.0% 0.0% 0.0% 7.77sec 62612 300.48sec
mechagnome mechagnome combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.77sec 0 300.48sec
mechagnome mechagnome conflagration_flare_up 205345 7194 24 5.95 153 383 29.8 29.8 38.4% 0.0% 0.0% 0.0% 9.73sec 7194 300.48sec
mechagnome mechagnome dragons_breath 31661 3231 11 0.16 0 3989 0.8 0.8 100.0% 0.0% 0.0% 0.0% 97.57sec 3231 300.48sec
mechagnome mechagnome dreadfire_vessel 344732 47322 157 0.66 11648 23304 3.3 3.3 23.7% 0.0% 0.0% 0.0% 103.91sec 47322 300.48sec
mechagnome mechagnome fire_blast 108853 183354 610 8.45 0 4335 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.15sec 183354 300.48sec
mechagnome mechagnome fireball 133 187394 624 15.46 1692 3518 77.4 77.4 39.9% 0.0% 0.0% 0.0% 3.39sec 187394 300.48sec
mechagnome mechagnome conflagration ticks -226757 8592 29 28.69 36 92 77.4 143.4 42.6% 0.0% 0.0% 0.0% 3.39sec 8592 300.48sec
mechagnome mechagnome flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
mechagnome mechagnome food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
mechagnome mechagnome ignite ticks -12654 291889 973 59.84 976 0 264.7 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 291889 300.48sec
mechagnome mechagnome mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.45sec 0 300.48sec
mechagnome mechagnome_mirror_image frostbolt 59638 11099 98 124.82 38 76 236.0 235.3 24.3% 0.0% 0.0% 0.0% 3.45sec 11099 113.09sec
mechagnome mechagnome phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.73sec 0 300.48sec
mechagnome mechagnome phoenix_flames_splash 257542 73994 246 2.81 2158 6082 14.1 14.1 78.8% 0.0% 0.0% 0.0% 21.72sec 73994 300.48sec
mechagnome mechagnome potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
mechagnome mechagnome pyroblast 11366 623573 2075 19.41 3151 7885 96.5 97.2 69.0% 0.0% 0.0% 0.0% 3.10sec 623573 300.48sec
mechagnome mechagnome pyroblast_dot ticks -321712 39887 133 35.54 139 354 97.2 177.7 39.6% 0.0% 0.0% 0.0% 3.10sec 39887 300.48sec
mechagnome mechagnome rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.79sec 0 300.48sec
mechagnome mechagnome scorch 2948 65126 217 6.73 0 1932 33.7 33.7 100.0% 0.0% 0.0% 0.0% 7.47sec 65126 300.48sec
night_elf night_elf combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.55sec 0 300.48sec
night_elf night_elf conflagration_flare_up 205345 7110 24 5.97 150 373 29.9 29.9 39.5% 0.0% 0.0% 0.0% 9.82sec 7110 300.48sec
night_elf night_elf dragons_breath 31661 3355 11 0.17 0 3897 0.9 0.9 100.0% 0.0% 0.0% 0.0% 113.02sec 3355 300.48sec
night_elf night_elf dreadfire_vessel 344732 48387 161 0.66 11657 23308 3.3 3.3 26.0% 0.0% 0.0% 0.0% 103.80sec 48387 300.48sec
night_elf night_elf fire_blast 108853 180055 599 8.45 0 4254 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.14sec 180055 300.48sec
night_elf night_elf fireball 133 183706 611 15.37 1653 3448 77.0 77.0 40.8% 0.0% 0.0% 0.0% 3.42sec 183706 300.48sec
night_elf night_elf conflagration ticks -226757 8472 28 28.66 35 90 77.0 143.3 43.7% 0.0% 0.0% 0.0% 3.41sec 8472 300.48sec
night_elf night_elf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
night_elf night_elf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
night_elf night_elf ignite ticks -12654 288435 961 59.84 964 0 264.9 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 288435 300.48sec
night_elf night_elf mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 300.48sec
night_elf night_elf_mirror_image frostbolt 59638 11021 97 124.81 37 75 236.0 235.3 25.4% 0.0% 0.0% 0.0% 3.45sec 11021 113.10sec
night_elf night_elf phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.71sec 0 300.48sec
night_elf night_elf phoenix_flames_splash 257542 72580 242 2.81 2093 5979 14.1 14.1 78.6% 0.0% 0.0% 0.0% 21.71sec 72580 300.48sec
night_elf night_elf potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
night_elf night_elf pyroblast 11366 618307 2058 19.58 3079 7739 97.3 98.0 69.3% 0.0% 0.0% 0.0% 3.08sec 618307 300.48sec
night_elf night_elf pyroblast_dot ticks -321712 39472 132 35.68 136 347 98.0 178.4 40.4% 0.0% 0.0% 0.0% 3.07sec 39472 300.48sec
night_elf night_elf rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.33sec 0 300.48sec
night_elf night_elf scorch 2948 63044 210 6.68 0 1885 33.4 33.4 100.0% 0.0% 0.0% 0.0% 7.83sec 63044 300.48sec
no_race no_race combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.68sec 0 300.48sec
no_race no_race conflagration_flare_up 205345 7045 23 5.96 150 376 29.9 29.9 38.1% 0.0% 0.0% 0.0% 9.72sec 7045 300.48sec
no_race no_race dragons_breath 31661 3137 10 0.16 0 3903 0.8 0.8 100.0% 0.0% 0.0% 0.0% 94.69sec 3137 300.48sec
no_race no_race dreadfire_vessel 344732 47946 160 0.65 11652 23268 3.3 3.3 25.6% 0.0% 0.0% 0.0% 103.96sec 47946 300.48sec
no_race no_race fire_blast 108853 179943 599 8.45 0 4255 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.16sec 179943 300.48sec
no_race no_race fireball 133 183422 610 15.45 1656 3444 77.4 77.4 39.9% 0.0% 0.0% 0.0% 3.43sec 183422 300.48sec
no_race no_race conflagration ticks -226757 8434 28 28.68 36 90 77.4 143.4 42.7% 0.0% 0.0% 0.0% 3.43sec 8434 300.48sec
no_race no_race flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
no_race no_race food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
no_race no_race ignite ticks -12654 286641 955 59.84 958 0 264.7 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 286641 300.48sec
no_race no_race mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 300.48sec
no_race no_race_mirror_image frostbolt 59638 10916 97 124.81 37 75 236.0 235.3 24.4% 0.0% 0.0% 0.0% 3.45sec 10916 113.11sec
no_race no_race phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.70sec 0 300.48sec
no_race no_race phoenix_flames_splash 257542 72734 242 2.82 2097 5983 14.1 14.1 78.8% 0.0% 0.0% 0.0% 21.69sec 72734 300.48sec
no_race no_race potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
no_race no_race pyroblast 11366 612671 2039 19.43 3084 7742 96.6 97.3 68.9% 0.0% 0.0% 0.0% 3.08sec 612671 300.48sec
no_race no_race pyroblast_dot ticks -321712 39104 130 35.54 136 348 97.3 177.7 39.6% 0.0% 0.0% 0.0% 3.07sec 39104 300.48sec
no_race no_race rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 59.59sec 0 300.48sec
no_race no_race scorch 2948 63417 211 6.71 0 1887 33.6 33.6 100.0% 0.0% 0.0% 0.0% 7.41sec 63417 300.48sec
pandaren pandaren combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.96sec 0 300.48sec
pandaren pandaren conflagration_flare_up 205345 7182 24 5.97 152 380 29.9 29.9 38.8% 0.0% 0.0% 0.0% 9.77sec 7182 300.48sec
pandaren pandaren dragons_breath 31661 3121 10 0.16 0 3943 0.8 0.8 100.0% 0.0% 0.0% 0.0% 93.29sec 3121 300.48sec
pandaren pandaren dreadfire_vessel 344732 47501 158 0.66 11660 23335 3.3 3.3 24.0% 0.0% 0.0% 0.0% 104.06sec 47501 300.48sec
pandaren pandaren fire_blast 108853 181898 605 8.45 0 4300 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.15sec 181898 300.48sec
pandaren pandaren fireball 133 185803 618 15.47 1676 3486 77.5 77.4 39.9% 0.0% 0.0% 0.0% 3.42sec 185803 300.48sec
pandaren pandaren conflagration ticks -226757 8535 28 28.69 36 91 77.4 143.5 42.8% 0.0% 0.0% 0.0% 3.40sec 8535 300.48sec
pandaren pandaren flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
pandaren pandaren food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
pandaren pandaren ignite ticks -12654 289784 966 59.84 968 0 264.7 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 289784 300.48sec
pandaren pandaren mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.46sec 0 300.48sec
pandaren pandaren_mirror_image frostbolt 59638 11045 98 124.82 38 75 236.0 235.3 24.4% 0.0% 0.0% 0.0% 3.45sec 11045 113.10sec
pandaren pandaren phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.70sec 0 300.48sec
pandaren pandaren phoenix_flames_splash 257542 73496 245 2.82 2117 6044 14.1 14.1 78.8% 0.0% 0.0% 0.0% 21.68sec 73496 300.48sec
pandaren pandaren potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
pandaren pandaren pyroblast 11366 618668 2059 19.39 3122 7836 96.4 97.1 68.9% 0.0% 0.0% 0.0% 3.11sec 618668 300.48sec
pandaren pandaren pyroblast_dot ticks -321712 39540 132 35.53 138 352 97.1 177.7 39.5% 0.0% 0.0% 0.0% 3.11sec 39540 300.48sec
pandaren pandaren rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 59.24sec 0 300.48sec
pandaren pandaren scorch 2948 64379 214 6.73 0 1909 33.7 33.7 100.0% 0.0% 0.0% 0.0% 7.77sec 64379 300.48sec
void_elf void_elf combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.39sec 0 300.48sec
void_elf void_elf conflagration_flare_up 205345 7044 23 5.95 150 376 29.8 29.8 38.2% 0.0% 0.0% 0.0% 9.75sec 7044 300.48sec
void_elf void_elf dragons_breath 31661 3023 10 0.15 0 3905 0.8 0.8 100.0% 0.0% 0.0% 0.0% 103.05sec 3023 300.48sec
void_elf void_elf dreadfire_vessel 344732 47510 158 0.66 11653 23291 3.3 3.3 24.0% 0.0% 0.0% 0.0% 103.70sec 47510 300.48sec
void_elf void_elf entropic_embrace 259756 18784 63 38.79 97 0 194.4 194.3 0.0% 0.0% 0.0% 0.0% 1.49sec 18784 300.48sec
void_elf void_elf fire_blast 108853 180053 599 8.45 0 4257 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.15sec 180053 300.48sec
void_elf void_elf fireball 133 183811 612 15.44 1659 3451 77.3 77.3 40.1% 0.0% 0.0% 0.0% 3.42sec 183811 300.48sec
void_elf void_elf conflagration ticks -226757 8442 28 28.69 36 90 77.3 143.4 42.7% 0.0% 0.0% 0.0% 3.41sec 8442 300.48sec
void_elf void_elf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
void_elf void_elf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
void_elf void_elf ignite ticks -12654 287120 957 59.84 960 0 264.7 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 287120 300.48sec
void_elf void_elf mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.47sec 0 300.48sec
void_elf void_elf_mirror_image frostbolt 59638 10943 97 124.82 37 75 236.0 235.3 24.4% 0.0% 0.0% 0.0% 3.45sec 10943 113.08sec
void_elf void_elf phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.68sec 0 300.48sec
void_elf void_elf phoenix_flames_splash 257542 72719 242 2.81 2101 5990 14.1 14.1 78.8% 0.0% 0.0% 0.0% 21.68sec 72719 300.48sec
void_elf void_elf potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
void_elf void_elf pyroblast 11366 614049 2044 19.44 3093 7759 96.7 97.4 68.9% 0.0% 0.0% 0.0% 3.08sec 614049 300.48sec
void_elf void_elf pyroblast_dot ticks -321712 39258 131 35.59 136 349 97.4 178.0 39.6% 0.0% 0.0% 0.0% 3.07sec 39258 300.48sec
void_elf void_elf rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.00sec 0 300.48sec
void_elf void_elf scorch 2948 63625 212 6.72 0 1890 33.7 33.7 100.0% 0.0% 0.0% 0.0% 7.52sec 63625 300.48sec
worgen worgen combustion 190319 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 70.69sec 0 300.48sec
worgen worgen conflagration_flare_up 205345 7098 24 5.97 150 374 29.9 29.9 39.1% 0.0% 0.0% 0.0% 9.65sec 7098 300.48sec
worgen worgen dragons_breath 31661 3198 11 0.16 0 3889 0.8 0.8 100.0% 0.0% 0.0% 0.0% 94.04sec 3198 300.48sec
worgen worgen dreadfire_vessel 344732 48300 161 0.66 11646 23324 3.3 3.3 26.1% 0.0% 0.0% 0.0% 103.33sec 48300 300.48sec
worgen worgen fire_blast 108853 179868 599 8.45 0 4250 42.3 42.3 100.0% 0.0% 0.0% 0.0% 7.14sec 179868 300.48sec
worgen worgen fireball 133 183501 611 15.38 1653 3438 77.0 77.0 40.9% 0.0% 0.0% 0.0% 3.40sec 183501 300.48sec
worgen worgen conflagration ticks -226757 8455 28 28.67 35 90 77.0 143.3 43.5% 0.0% 0.0% 0.0% 3.39sec 8455 300.48sec
worgen worgen flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
worgen worgen food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
worgen worgen ignite ticks -12654 287763 959 59.84 962 0 264.9 299.2 0.0% 0.0% 0.0% 0.0% 1.13sec 287763 300.48sec
worgen worgen mirror_image 55342 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 300.48sec
worgen worgen_mirror_image frostbolt 59638 11022 97 124.81 37 75 236.0 235.3 25.5% 0.0% 0.0% 0.0% 3.45sec 11022 113.10sec
worgen worgen phoenix_flames 257541 0 0 0.00 0 0 14.1 0.0 0.0% 0.0% 0.0% 0.0% 21.72sec 0 300.48sec
worgen worgen phoenix_flames_splash 257542 72413 241 2.81 2092 5968 14.1 14.1 78.6% 0.0% 0.0% 0.0% 21.72sec 72413 300.48sec
worgen worgen potion 307162 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.48sec
worgen worgen pyroblast 11366 616186 2051 19.54 3080 7723 97.2 97.9 69.3% 0.0% 0.0% 0.0% 3.09sec 616186 300.48sec
worgen worgen pyroblast_dot ticks -321712 39393 131 35.65 136 347 97.9 178.3 40.4% 0.0% 0.0% 0.0% 3.09sec 39393 300.48sec
worgen worgen rune_of_power 116011 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 60.25sec 0 300.48sec
worgen worgen scorch 2948 63508 211 6.71 0 1889 33.6 33.6 100.0% 0.0% 0.0% 0.0% 6.88sec 63508 300.48sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
67162.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 47.5sec 10.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 139.3s

Stack Uptimes

  • Health Decade (0 - 10)_1:11.01%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 25.2sec 7.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.1s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.48%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 30.9sec 10.24% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 46.0s

Stack Uptimes

  • Health Decade (20 - 30)_1:10.24%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.5sec 10.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.5s / 49.1s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.91%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.7sec 12.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.0s / 55.8s

Stack Uptimes

  • Health Decade (40 - 50)_1:12.01%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.1sec 11.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.4s / 45.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.84%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 34.7sec 11.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.1s / 55.1s

Stack Uptimes

  • Health Decade (60 - 70)_1:11.67%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 35.5sec 11.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.2s / 42.7s

Stack Uptimes

  • Health Decade (70 - 80)_1:11.99%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 26.0sec 8.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:12.4s / 48.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:8.77%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 14.9sec 4.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.13%
Sinful Revelation 10.3 6.5 28.3sec 16.9sec 12.8sec 44.09% 0.00% 6.5 (6.5) 9.9

Buff Details

  • buff initial source:fire
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 99.8s
  • trigger_min/max:0.0s / 66.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.8s

Stack Uptimes

  • sinful_revelation_1:44.09%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.5 28.2sec 16.8sec 12.8sec 44.61% 0.00% 6.5 (6.5) 10.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 83.7s
  • trigger_min/max:0.0s / 70.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.7s

Stack Uptimes

  • sinful_revelation_1:44.61%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.3 6.3 28.4sec 17.1sec 12.7sec 43.75% 0.00% 6.3 (6.3) 9.9

Buff Details

  • buff initial source:human
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 86.8s
  • trigger_min/max:0.0s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 83.0s

Stack Uptimes

  • sinful_revelation_1:43.75%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.4 28.3sec 17.0sec 12.7sec 43.99% 0.00% 6.4 (6.4) 9.9

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 93.2s
  • trigger_min/max:0.0s / 72.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.3s

Stack Uptimes

  • sinful_revelation_1:43.99%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.2 28.3sec 17.2sec 12.7sec 43.89% 0.00% 6.2 (6.2) 9.9

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 86.8s
  • trigger_min/max:0.0s / 68.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 63.0s

Stack Uptimes

  • sinful_revelation_1:43.89%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.4 28.3sec 17.0sec 12.8sec 44.19% 0.00% 6.4 (6.4) 10.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 110.4s
  • trigger_min/max:0.0s / 66.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 79.7s

Stack Uptimes

  • sinful_revelation_1:44.19%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.4 28.4sec 17.1sec 12.8sec 44.05% 0.00% 6.4 (6.4) 9.9

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 87.1s
  • trigger_min/max:0.0s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.2s

Stack Uptimes

  • sinful_revelation_1:44.05%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.5 6.3 28.1sec 17.1sec 12.7sec 44.09% 0.00% 6.3 (6.3) 10.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 84.9s
  • trigger_min/max:0.0s / 68.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.9s

Stack Uptimes

  • sinful_revelation_1:44.09%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.3 6.3 28.4sec 17.1sec 12.8sec 43.95% 0.00% 6.3 (6.3) 9.9

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 87.0s
  • trigger_min/max:0.0s / 68.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.8s

Stack Uptimes

  • sinful_revelation_1:43.95%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.3 6.5 28.4sec 17.0sec 12.8sec 44.05% 0.00% 6.5 (6.5) 9.9

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 83.7s
  • trigger_min/max:0.0s / 71.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 64.3s

Stack Uptimes

  • sinful_revelation_1:44.05%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.3 28.1sec 17.0sec 12.7sec 44.14% 0.00% 6.3 (6.3) 10.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 90.4s
  • trigger_min/max:0.0s / 71.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.0s

Stack Uptimes

  • sinful_revelation_1:44.14%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.4 28.3sec 17.0sec 12.8sec 44.04% 0.00% 6.4 (6.4) 9.9

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 95.8s
  • trigger_min/max:0.0s / 69.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.8s

Stack Uptimes

  • sinful_revelation_1:44.04%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.4 6.3 28.3sec 17.2sec 12.7sec 43.92% 0.00% 6.3 (6.3) 9.9

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 91.5s
  • trigger_min/max:0.0s / 70.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.1s

Stack Uptimes

  • sinful_revelation_1:43.92%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 10.3 6.4 28.3sec 17.0sec 12.8sec 44.01% 0.00% 6.4 (6.4) 9.9

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 90.6s
  • trigger_min/max:0.0s / 70.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 86.0s

Stack Uptimes

  • sinful_revelation_1:44.01%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1717
Mean 300.48
Minimum 240.05
Maximum 359.85
Spread ( max - min ) 119.80
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
Fluffy_Pillow Damage Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1717
Mean 71522.56
Minimum 68054.65
Maximum 75575.58
Spread ( max - min ) 7520.93
Range [ ( max - min ) / 2 * 100% ] 5.26%
Standard Deviation 1273.8595
5th Percentile 69592.58
95th Percentile 73798.52
( 95th Percentile - 5th Percentile ) 4205.94
Mean Distribution
Standard Deviation 30.7423
95.00% Confidence Interval ( 71462.30 - 71582.81 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1219
0.1 Scale Factor Error with Delta=300 13853
0.05 Scale Factor Error with Delta=300 55410
0.01 Scale Factor Error with Delta=300 1385246
HPS
Fluffy_Pillow Healing Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1717
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 158
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 21737557 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.